FZD3 Membrane Protein Introduction

Introduction of FZD3

FZD3 is a 7-transmembrane receptor belonging to the frizzled family. In human, FZD3 is encoded by the FZD3 gene which consists of eight exons and located on chromosome 8p21. It belongs to the G-protein-coupled receptor (GPCR) family which has been studied well during the past few decades as it presents great potential for therapeutic applications. As one of the ten subtypes of the Frizzled family (FZD1, FZD2, FZD3, FZD4, FZD5, FZD6, FZD7, FZD8, FZD9, FZD10), it contains seven transmembrane domains with 666 amino acids.

Basic Information of FZD3
Protein Name	Frizzled-3
Gene Name	FZD3
Aliases	Fz-3
Organism	Homo sapiens (Human)
UniProt ID	Q9NPG1
Transmembrane Times	7
Length (aa)	666
Sequence	MAMTWIVFSLWPLTVFMGHIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAALAMEPFHPMVN LDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRL VDLNLAGEPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFLHVRDCSPPCPNMYFRREELSFARYFIGLIS IICLSATLFTFLTFLIDVTRFRYPERPIIFYAVCYMMVSLIFFIGFLLEDRVACNASIPAQYKASTVTQG SHNKACTMLFMILYFFTMAGSVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMN KIEGDNISGVCFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR IGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILFLMKYLMALIV GIPSVFWVGSKKTCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDPNTPIIRKSRGTSTQGTSTHA SSTQLAMVDDQRSKAGSIHSKVSSYHGSLHRSRDGRYTPCSYRGMEERLPHGSMSRLTDHSRHSSSHRLN EQSRHSSIRDLSNNPMTHITHGTSMNRVIEEDGTSA

Function of FZD3 Membrane Protein

The Wnt-signaling pathway has been implicated in a series of processes during the neurodevelopment and frizzled family has been proved to be the receptors for Wnt ligands. It has been reported that Frizzled family plays key roles in cell proliferation, governing cell polarity, formation of neural synapses, embryonic development, and some other processes in developing and adult organisms. Especially, FZD3 is necessary for the formation of the neural crest and major fiber tracts in the CNS. In this case, FZD3 would be associated with the susceptibility to schizophrenia. Diseases associated with FZD3 include Substance-Induced Psychosis and Schizophrenia. Moreover, it has been reported that FZD3 plays an important role in the development of most longitudinal tracts in the central nervous system.

Fig.1 Structure of Frizzled family.

Application of FZD3 Membrane Protein in Literature

Türkmen S., et al. A Novel de novo FZD2 Mutation in a Patient with Autosomal Dominant Omodysplasia. Molecular Syndromology. 2017, 8(6):318. PubMed ID: 29230162

OMOD2 is one kind of rare skeletal dysplasia with the characterizations of facial dysmorphism and shortness of the upper extremities. This article reports that heterozygous FZD2mutations may be disease-causing for OMOD2.
Wang W., et al. Feedback regulation of apical progenitor fate by immature neurons through Wnt7-Celsr3-Fzd3 signaling. Nature Communications. 2016, 7:10936. PubMed ID: 26939553

This article reveals that the sequential generation of neurons and glial cells is necessary for the wiring and function of the cerebral cortex during development. Celsr3 and FZD3 enable the response of immature neurons Wnt7, and then upregulate Jag1 and thereby accomplish the feedback regulation of apical progenitor fate via Wnt7-Celsr3-Fzd3 signaling.
Su L., et al. Deregulation of the planar cell polarity genes CELSR3 and FZD3 in Hirschsprung disease. Experimental & Molecular Pathology. 2016, 101(2):241-248. PubMed ID: 27619161

This article reveals that the deregulation of the planar cell polarity genesCELSR3 and FZD3 might disrupt the enteric innervation pattern and finally result in the susceptibility to HSCR.
Jia F., et al. Celsr3 and Fzd3 Organize a Pioneer Neuron Scaffold to Steer Growing Thalamocortical Axons. Cerebral Cortex. 2016, 26(7):3323-3334. PubMed ID: 27170656

This article reveals that Celsr3 and FZD3 enable the formation of the scaffold of pioneer neurons and their axons. This scaffold is able to extend from prethalamus to subcortex and ventral telencephalon and finally steers reciprocal corticothalamic fibers.
Chai G., et al. Celsr3 and Fzd3 in axon guidance. International Journal of Biochemistry & Cell Biology. 2015, 64:11-14. PubMed ID: 25813877

This article reports that the assembly of functional neuronal circuits always depends on the correct wiring of axons and dendrites. The seven-transmembrane domain receptors Celsr3 and Fzd3 are able to regulate the development of most longitudinal tracts in the central nervous system, and axon navigation in the peripheral, sympathetic and enteric nervous systems.

FZD3 Preparation Options

In order to obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-FZD3 antibody development services.

Creative Biolabs is an expert in the field of membrane protein preparation, we are pleased to use our extensive experience and advanced platform to offer the best service and the most qualified products to satisfy each demand of our customers. If you are interested in our membrane proteins preparation service, please do not hesitate to contact us for more details.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: