Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of FZD6
FZD6 is encoded by the FZD6 gene. It belongs to the G-protein-coupled receptor (GPCR) family which shows numerous possibilities for therapeutic applications in recent decades. FZD6 is one of the ten subtypes of the Frizzled family (FZD1, FZD2, FZD3, FZD4, FZD5, FZD6, FZD7, FZD8, FZD9, FZD10) with 706 amino acids. Different from other family members, FZD6 does not contain the C-terminal PDZ domain-binding motif.
| Basic Information of FZD6 | |
| Protein Name | Frizzled-6 |
| Gene Name | FZD6 |
| Aliases | FZ6, FZ-6, HFZ6, NDNC10 |
| Organism | Homo sapiens (Human) |
| UniProt ID | O60353 |
| Transmembrane Times | 7 |
| Length (aa) | 706 |
| Sequence |
MEMFTFLLTCIFLPLLRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECS PNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPH TEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQCAPPCPNMYFKSDELEFAKSFIGTVSIFCL CATLFTFLTFLIDVRRFRYPERPIIYYSVCYSIVSLMYFIGFLLGDSTACNKADEKLELGDTVVLGSQNK ACTVLFMLLYFFTMAGTVWWVILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGTPGFLTVMLLAMNKVEG DNISGVCFVGLYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF SGLYLVPLVTLLGCYVYEQVNRITWEITWVSDHCRQYHIPCPYQAKAKARPELALFMIKYLMTLIVGISA VFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHKKKHYKPSSHKLKVISKSMGT STGATANHGTSAVAITSHDYLGQETLTEIQTSPETSMREVKADGASTPRLREQDCGEPASPAASISRLSG EQVDGKGQAGSVSESARSEGRISPKSDITDTGLAQSNNLQVPSSSEPSSLKGSTSLLVHPVSGVRKEQGG GCHSDT |
Function of FZD6 Membrane Protein
FZD6 belongs to the Frizzled family whose members have been served as receptors for Wnt signaling proteins. In general, the frizzled receptors can be coupled to the β-catenin canonical signaling pathway and finally leads to various applications, such as inhibition of GSK-3 kinase, activation of Wnt target genes, activation of disheveled proteins, and nuclear accumulation of β-catenin. The FZD6 is over-expressed in the keratogenous zone of the ventral matrix. FZD6 has been shown to act as the positive regulator for the noncanonical WNT or planar cell polarity pathway and the negative regulator for the canonical WNT/β-catenin signaling cascade. The diseases related to FZD6 include nail disorder and nail disease. It has been reported that FZD6 mutation has been identified in isolated nail dysplasia.
Fig.1 Structure of FZD6.
Application of FZD6 Membrane Protein in Literature
Liver tumor-initiating cells (TICs) are the drivers for liver tumorigenesis. This article reports that IncFZD6 enables the promotion of Wnt/β-catenin activation and self-renewal of liver TIC via BRG1-dependent FZD6 expression.
This article reports that FZD6 is frequently amplified in breast cancer and increase the incidence of the triple negative breast cancer subtype. The FZD6-fibronectin-actin axis might be used for the drug development of breast cancer.
This article reveals that the FZD6-regulated Wnt non-canonical pathway plays an important role in the pathogenesis of various human malignancies. The research of FZD6 might result in the identification of new targets for cancer treatment.
This article reveals that the research of FZD6 might be the first step for the diagnostic of autosomal recessive NDNC patients with enlarged nails.
This article reports that FZD6 works as the negative regulator of TCF4-miR-125b/miR-20b-FZD6 via the activation of CaMKII-TAK1-NLK signaling. The components of this circuit relate to the prognostic of clinical glioblastoma (GBM). This article provides insights into GBM pathogenesis understanding and treatment.
FZD6 Preparation Options
In order to harvest the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-FZD6 antibody development services.
As a pioneer and the undisputed global leader in the field of membrane protein preparation, Creative Biolabs offers the most comprehensive membrane protein services. Our various strategies can be tailor-designed to meet your specific needs. If you are interested in our services, please feel free to contact us for more information.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
