Close

FZD7 Membrane Protein Introduction

Introduction of FZD7

Frizzled is a family of G protein-coupled receptor proteins, which serves as receptors in the Wnt signaling pathway and other signaling pathways. When activated, Frizzled leads to activation of Disheveled in the cytosol. Frizzled proteins and the genes encoding them have been identified in a series of animals from sponges to humans. Frizzled-7 (FZD7) is a protein that in humans encoded by the FZD7 gene. Members of the frizzled gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD7 protein contains an N-terminal signal sequence, seven putative transmembrane domains, ten cysteine residues typical of the cysteine-rich extracellular domain of 10 typical Fz family members, and an intracellular C-terminal tail with a PDZ domain-binding motif.

Basic Information of FZD7
Protein Name Frizzled-7
Gene Name FZD7
Aliases Fz-7, hFz7, FzE3
Organism Homo sapiens (Human)
UniProt ID O75084
Transmembrane Times 7
Length (aa) 574
Sequence MRDPGAAAPLSSLGLCALVLALLGALSAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDI
AYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPC
RSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYP
TAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRAN
GLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVA
VAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLT
WFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDA
LRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTV
PATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIV
GITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV

Function of FZD7 Membrane Protein

FZD7 is an important oncogene in multiple human malignancies and involved in regulating sensitivity to chemotherapeutic drugs. FZD7 gene expression may downregulate the function of APC and enhance beta-catenin-mediated signals in poorly differentiated human esophageal cancer. Knockdown of FZD7 inhibits cell growth and metastasis and promotes chemosensitivity of esophageal squamous cell carcinoma cells by inhibiting Wnt signaling. The Fzd7 receptor also plays a key role in Wnt signaling during homeostasis of gastric epithelial cells. FZD7 expression is increased in animal models of TGF-β1-induced pulmonary fibrosis. In addition, microRNA-485-5p represses melanoma cell invasion and proliferation by suppressing FZD7 and the miR-485-5p/FZD7 axis may be a promising therapeutic target for melanoma.

Frizzled-7 can act in different branches of the Wnt-signaling cascade. Fig.1 Frizzled-7 can act in different branches of the Wnt-signalling cascade. (Sachdeva, 2013)

Application of FZD7 Membrane Protein in Literature

  1. Guan S., et al. Frizzled-7 mediates TGF-β-induced pulmonary fibrosis by transmitting non-canonical Wnt signaling. Exp Cell Res. 2017, 359(1): 226-234. PubMed ID: 28736081

    This article reports that FZD7 transmits non-canonical Wnt signaling by interacting Wnt5A in the regulation of ECM expression. Both Wnt and TGF-β signaling are involved in the regulation of organ fibrosis, whereas TGF-β1 treatment induces a significant upregulation of FZD7 in human lung fibroblasts.

  2. Zheng Z., et al. Lumbar sympathectomy reduces vascular permeability, possibly through decreased adenosine receptor A2a expression in the hind plantar skin of rats. Clin Hemorheol Microcirc. 2018, 68(1): 5-15. PubMed ID: 29439317

    This article evaluates the function of FZD7 in esophageal squamous cell carcinoma (ESCC). It shows that both mRNA and protein expression levels of FZD7 were highly upregulated in ESCC cell lines.FZD7 might serve as a potential therapeutic target for the treatment of ESCC.

  3. Flanagan D. J., et al. Loss of the Wnt receptor frizzled 7 in the mouse gastric epithelium is deleterious and triggers rapid repopulation in vivo. Chem Biol Drug Des. 2017, 10(8): 971-980. PubMed ID: 28600348

    Wnt signaling regulates several cell functions and is important for the homeostasis of the gastric epithelium. The article reports that gastric-specific loss of Fzd7 in the adult gastric epithelium of mice is deleterious and triggers rapid epithelial repopulation. This provides a critical evidence of a crucial role for Wnt signaling, via the Fzd7 receptor, during homeostasis of the gastric epithelium.

  4. Wu J., et al. MicroRNA-485-5p represses melanoma cell invasion and proliferation by suppressing Frizzled7. Biomed Pharmacother. 2017, 90: 303-310. PubMed ID: 28364602

    Authors in this group observed that miR-485-5p potentially targets the 3'-untranslated region (3'-UTR) of FZD7. miR-485-5p regulates Wnt signaling and represses melanoma cell invasion and proliferation by suppressing FZD7, which indicates a new tumor-suppressive role for miR-485-5p in melanoma.

  5. Qiu X., et al. Overexpression of FZD7 promotes glioma cell proliferation by upregulating TAZ. Oncotarget. 2016, 7(52): 85987-85999. PubMed ID: 27852064

    This article demonstrates that FZD7 may promote glioma cell proliferation by upregulation of TAZ. FZD7 is important in the development of various tumors and high-level FZD7 expression in glioma and its overexpression is associated with advanced tumor stage.

FZD7 Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-FZD7 antibody development services.


Creative Biolabs is a world-leading member protein provider and we now offer all-around, custom-oriented service of Magic™ membrane protein production. We are happy to leverage our advanced techniques and extensive expertise in this field to satisfy every single custom demand. Please do not hesitate to inquire us for more details.

Reference

  1. Vincan E, et al. (2007). Frizzled7 dictates embryonic morphogenesis: implications for colorectal cancer progression. Front Biosci. 2, 4558-67.

Online Inquiry

Verification code
Click image to refresh the verification code.

CONTACT US

45-1 Ramsey Road, Shirley, NY 11967, USA
Call us at:
USA: 1-631-381-2994
Europe: 44-207-097-1828
Fax: 1-631-207-8356
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us