Close

GABBR1 Membrane Protein Introduction

Introduction of GABBR1

GABBR1 is encoded by the GABBR1 gene. The GABBR1 gene is located in humans at 6p21.3. It contains 22 exons and its mRNA is 4.4 kb in length. It is a G-protein coupled receptor subunit, inhibition of adenylyl cyclase activity, stimulation of phospholipase A2, activation of potassium channels, inactivation of voltage-dependent calcium channels, and modulation of inositol phospholipid hydrolysis of G-proteins mediate their activity. GABBR1 plays a key role in the fine-tuning of inhibitory synaptic transmission.

Basic Information of GABBR1
Protein Name Gamma-aminobutyric acid type B receptor subunit 1
Gene Name GABBR1
Aliases GABABR1, GABBR1-3, GB1, GPRC3A, dJ271M21.1.1, dJ271M21.1.2
Organism Homo sapiens (Human)
UniProt ID Q9UBS5
Transmembrane Times 7
Length (aa) 961
Sequence MLLLLLLAPLFLRPPGAGGAQTPNATSEGCQIIHPPWEGGIRYRGLTRDQVKAINFLPVDYEIE
YVCRGEREVVGPKVRKCLANGSWTDMDTPSRCVRICSKSYLTLENGKVFLTGGDLPALDGARVD
FRCDPDFHLVGSSRSICSQGQWSTPKPHCQVNRTPHSERRAVYIGALFPMSGGWPGGQACQPAV
EMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEA
ARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFT
STLDDLEERVKEAGIEITFRQSFFSDPAVPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLF
GKKYVWFLIGWYADNWFKIYDPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVE
KLTKRLKRHPEETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQTITDQIYRA
MNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPAD
QTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLA
LAAVFPLGLDGYHIGRNQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKT
LEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSRKMNT
WLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDA
AFAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENR
ELEKIIAEKEERVSELRHQLQSRQQLRSRRHPPTPPEPSGGLPRGPPEPPDRLSCDGSRVHLLYK

Function of GABBR1 Membrane Protein

The GABA heterodimeric G protein-coupled receptors formed by GABBR1 and GABBR2 are within the heterodimeric GABA receptor, GABBR1 binding agonists, and GABBR2 mediates the coupling of G proteins. When the ligand binds to it, it causes a conformational change, and the regulation of the activity of the downstream effector is accomplished by triggering signal transduction by a guanine nucleotide binding protein (G protein), which eventually inhibits adenylyl cyclase, stimulating phospholipase A2, which activates potassium channels, inactivates voltage-dependent calcium channels and regulates the hydrolysis of inositol phospholipids. Presynaptic GABA receptors down-regulate high voltage-activated calcium channels to inhibit neurotransmitter release. Moreover, postsynaptic GABA receptors reduce neuronal excitability by activating prominent inward rectifier potassium (Kir) conductance as late inhibitory synapses post-potential basis.

Structure of GABA receptors subunit composition. Fig.1 Structure of GABA receptors subunit composition. (Eduardo, 2012)

Application of GABBR1 Membrane Protein in Literature

  1. Enoch M.A., et al. GABBR1 and SLC6A1, Two Genes Involved in Modulation of GABA Synaptic Transmission, Influence Risk for Alcoholism: Results from Three Ethnically Diverse Populations. Alcohol Clin Exp Res. 2016, 40(1): 93-101. PubMed ID: 26727527

    The article shows that with both GABBR1 and SLC6A1, the minor genotypes/alleles are protective against risk for alcoholism. Finally, GABBR1 rs29220 might predict treatment response/adverse effects for baclofen, a GABAB receptor agonist.

  2. Vangeel E.B., et al. Newborn genome-wide DNA methylation in association with pregnancy anxiety reveals a potential role for GABBR1. Clin Epigenetics. 2017, 9: 107. PubMed ID: 29026448

    This article reveals that pregnancy anxiety is associated with differential DNA methylation patterns in newborns and that candidate gene GABBR1 is associated with infant hypothalamic-pituitary-adrenal axis response to a stressor. The findings reveal a potential role for GABBR1 methylation in association with stress and provide grounds for further research.

  3. Longqiu Y., et al. A miRNAs panel promotes the proliferation and invasion of colorectal cancer cells by targeting GABBR1. Cancer Med. 2016, 5(8): 2022-31. PubMed ID: 27230463

    The article demonstrates that miR-106a/b, miR-20a/b and miR-17 promote the proliferation and invasion of colorectal cancer by targeting their common target gene GABBR1, and play a key role in the proliferation and invasion of colorectal cancer.

  4. Wang R., et al. Sympathoexcitation in Rats With Chronic Heart Failure Depends on Homeobox D10 and MicroRNA-7b Inhibiting GABBR1 Translation in Paraventricular Nucleus. Circ Heart Fail. 2016, 9(1): e002261. PubMed ID: 26699387

    This article indicates that there is an ANG II/AT1R/HoxD10/miR-7b/GABBR1 pathway in the PVN that contributes to sympathoexcitation and deterioration of cardiac function in CHF.

  5. Gumerov V., et al. MicroRNA-derived network analysis of differentially methylated genes in schizophrenia, implicating GABA receptor B1 [GABBR1] and protein kinase B [AKT1]. Biol Direct. 2015, 10: 59. PubMed ID: 26450699

    This article shows that GABBR1 is of central importance to schizophrenia, even if there was no direct causal relationship at that time. In addition to being the center of microRNA-derived regulatory pathways and protein-protein interactions, its centrality is also supported by a large number of cis-regulatory elements and transcription factor binding sites that regulate its transcription.

GABBR1 Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-GABBR1 antibody development services.


As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.

Reference

  1. Eduardo E. (2012). GABAB receptors: Structure, functions, and clinical implication. Neurology. 78, 578.

Online Inquiry

Verification code
Click image to refresh the verification code.

CONTACT US

45-1 Ramsey Road, Shirley, NY 11967, USA
Call us at:
USA: 1-631-381-2994
Europe: 44-207-097-1828
Fax: 1-631-207-8356
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us