Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of GALR2
The GalR2 receptor was first cloned from a rat, it contains 372 amino acid residues and its coding gene has an intron. Exon 1 encodes from the N-terminus of the receptor to the end of the third transmembrane segment, and exon 2 encodes the second intracellular loop to the C-terminus. The extracellular domain of the rat GalR2 receptor has three nitrogen-linked glycosylation sites, while the intracellular domain has a different phosphorylation site than the GalR1 receptor. The C-terminus of the human GalR2 receptor is 15 amino acid residues more than the GalR2 receptor in the rat, and its GalR1 and GalR2 receptors are only about 42% homologous, suggesting that these two receptors have different regulatory functions.
| Basic Information of GALR2 | |
| Protein Name | Galanin receptor type 2 |
| Gene Name | GALR2 |
| Aliases | GAL2-R, GALNR2, GALR-2, Galanin receptor 2 |
| Organism | Homo sapiens (Human) |
| UniProt ID | P47211 |
| Transmembrane Times | 7 |
| Length (aa) | 387 |
| Sequence |
MNVSGCPGAGNASQAGGGGGWHPEAVIVPLLFALIFLVGTVGNTLVLAVLLRGGQAVSTT NLFILNLGVADLCFILCCVPFQATIYTLDGWVFGSLLCKAVHFLIFLTMHASSFTLAAVS LDRYLAIRYPLHSRELRTPRNALAAIGLIWGLSLLFSGPYLSYYRQSQLANLTVCHPAWS APRRRAMDICTFVFSYLLPVLVLGLTYARTLRYLWRAVDPVAAGSGARRAKRKVTRMILI VAALFCLCWMPHHALILCVWFGQFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFR KGFRTICAGLLGRAPGRASGRVCAAARGTHSGSVLERESSDLLHMSEAAGALRPCPGASQ PCILEPCPGPSWQGPKAGDSILTVDVA |
Function of GALR2 Membrane Protein
GalR2 receptors may be coupled to Gq/11 proteins. They activate phospholipase C and promote synaptic transmission efficiency in GalR2 receptor expressing neurons. In addition, GalR2 receptors and forskolin are activated in CHO and HEK293 cells. The cAMP is conjugated and coupled to PKC-dependent MAPK activation in CHO cells, both of which are PTX-sensitive. These characteristics are coupled with Gi-coupled adenylyl cyclase inhibition and Go-coupled MAPK activation, indicating that the GalR2 receptor is also coupled to the Gi/o protein.
Fig.1 Neurons release GAL following injury or inflammation and activate tumour-expressed GALR2. (Scanlon, 2012)
Application of GALR2 Membrane Protein in Literature
This article reports that the galanin analog NAX 810-2 has a good preclinical character as a novel and first class analgesic.
This article reveals that NAX 810-2 effectively activates GalR2 at therapeutic concentrations.
The article reveals that the mechanism for the allosteric modulation caused by PAMs is the binding of the PAM at pocket III, which is formed by galanin, ECL2, TM2, TM3, and ECL1, which results in the disruption of the Na(+)-binding site and/or the Na(+) ion pathway, leading to GALR2 agonism.
This article shows that nonbrain-penetrating galanin analog reduces pain behaviors in several models and does not produce some of the dose-limiting toxicities associated with other analgesics.
This article evaluates that GALR2 stimulates tumor angiogenesis in SCCHN via p38-mediated inhibition of TTP with resultant enhanced cytokine secretion.
GALR2 Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-GALR2 antibody development services.
As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
