Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
Highlights
Introduction of GALR3
The GalR3 receptor was first cloned in rats and contained 370 amino acid residues. The human GalR3 receptor contains 368 amino acid residues, and its gene also has an intron at the same position as the GalR2 receptor gene, suggesting that the GalR2 and GalR3 receptors may have the same evolutionary origin. It shares higher homology with the human GalR2 receptor (about 58%) than human GalR1 receptor (about 38%). Human GalR3 receptor has about 90% homology with rat and is equally conserved N-terminal glycosylation sites and several phosphorylation sites, including a C-terminal PKC phosphorylation site not found in the GalR1 and GalR2 receptors.
| Basic Information of GALR3 | |
| Protein Name | Galanin receptor type 3 |
| Gene Name | GALR3 |
| Aliases | Galanin receptor 3 |
| Organism | Homo sapiens (Human) |
| UniProt ID | O60755 |
| Transmembrane Times | 7 |
| Length (aa) | 368 |
| Sequence |
MADAQNISLDSPGSVGAVAVPVVFALIFLLGTVGNGLVLAVLLQPGPSAWQEPGSTTDLF ILNLAVADLCFILCCVPFQATIYTLDAWLFGALVCKAVHLLIYLTMYASSFTLAAVSVDR YLAVRHPLRSRALRTPRNARAAVGLVWLLAALFSAPYLSYYGTVRYGALELCVPAWEDAR RRALDVATFAAGYLLPVAVVSLAYGRTLRFLWAAVGPAGAAAAEARRRATGRAGRAMLAV AALYALCWGPHHALILCFWYGRFAFSPATYACRLASHCLAYANSCLNPLVYALASRHFRA RFRRLWPCGRRRRHRARRALRRVRPASSGPPGCPGDARPSGRLLAGGGQGPEPREGPVHG GEAARGPE |
Function of GALR3 Membrane Protein
The functional coupling of the GalR3 receptor is similar to that of the GalR1 receptor. Galanin acts on the GalR3 receptor to activate its co-expressed inward rectifier potassium channel. GalR3 receptors regulate physiological processes such as mood, feeding, pain transmission, metabolism, and release of pituitary hormones. GalR3 receptors may also be involved in the regulation of insulin release and sugar homeostasis. RNA blot analysis showed high levels of GalR3 receptors in the frontal lobe, temporal lobe, striatum, medulla oblongata, cerebellum, and spinal cord. However, low levels in the hippocampus, amygdala, and thalamus.
Fig.1 Representative microphotographs of the joint samples taken on the 14 th day of arthritis. (Balint, 2015)
Application of GALR3 Membrane Protein in Literature
This article reports that GalR3 but not GalR2 is a specific receptor subtype that mediates the proliferative effect of galanin on hippocampal progenitor cells. GALR3 is involved in the mediation of galanin neurogenesis and may be a neurogenic antidepressant effect.
This article reveals that the modified GalR3 promotes its cell surface expression while maintaining wild-type receptor pharmacology. Modified GalR3 has been used to develop high throughput screening compatible cell-based cAMP biosensor assays to detect selective small molecule modulators of GalR3.
The article reports how galanin and its receptors are regulated by diabetes in vitro and in vivo. In addition, GalR3-mediated neuroprotection supports the development of potential future therapies based on GalR3 activation for the treatment of brain disorders.
This article shows that the combination of the GALR3 and GAL risk double models resulted in an OR increase in alcoholism. GALR1 or GALR2 has no effect on the risk of alcoholism. This evidence suggests that GALR3 mediates the alcohol-related effects of galanin.
This article evaluates that the galanin and the rat GalR3 receptor in the transfected cell line bind with similar affinity to GalR2 binding.
GALR3 Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-GALR3 antibody development services.
As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
