GHRHR Membrane Protein Introduction

Introduction of GHRHR

The growth hormone releasing hormone receptor (GHRHR) is a G protein-coupled receptor encoded by GHRHR. It leads to the synthesis and release of growth hormone after binding to growth hormone-releasing hormone. GHRHR activates Gs protein and cascades cAMP through adenylate cyclase, stimulating growth hormone cell growth, growth hormone gene transcription, and growth hormone secretion.

Basic Information of GHRHR
Protein Name	Growth hormone-releasing hormone receptor
Gene Name	GHRHR
Aliases	GHRH receptor, Growth hormone-releasing factor receptor, GRF receptor, GRFR
Organism	Homo sapiens (Human)
UniProt ID	Q02463
Transmembrane Times	7
Length (aa)	423
Sequence	MDRRMWGAHVFCVLSPLPTVLGHMHPECDFITQLREDESACLQAAEEMPNTTLGCPATWDGLL CWPTAGSGEWVTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEEESYF STVKIIYTVGHSISIVALFVAITILVALRRLHCPRNYVHTQLFTTFILKAGAVFLKDAALFHS DDTDHCSFSTVLCKVSVAASHFATMTNFSWLLAEAVYLNCLLASTSPSSRRAFWWLVLAGWGLP VLFTGTWVSCKLAFEDIACWDLDDTSPYWWIIKGPIVLSVGVNFGLFLNIIRILVRKLEPAQGS LHTQSQYWRLSKSTLFLIPLFGIHYIIFNFLPDNAGLGIRLPLELGLGSFQGFIVAILYCFLNQ EVRTEISRKWHGHDPELLPAWRTRAKWTTPSRSAAKVLTSMC

Function of GHRHR Membrane Protein

The GHRHR is coupled to the G protein of adenylyl cyclase. GHRHR activates the Gs protein after binding to hormones, and causes a cascade of cAMP via Adenylate cyclase, stimulating somatotroph cell growth, growth hormone gene transcription, growth hormone synthesis, and secretion. Growth hormone-releasing hormone (GHRH) and the receptor, GHRHR, constitute important components of the hypothalamus-pituitary growth axis and act on the downstream growth hormone (GH).

GHRHR Membrane Protein Introduction Fig.1 Crystal structure of the extracellular domain of human GHRHR.

Application of GHRHR Membrane Protein in Literature

Liang Guo., et al. GHRH, PRP-PACAP and GHRHR Target Sequencing via an Ion Torrent Personal Genome Machine Reveals an Association with Growth in Orange-Spotted Grouper (Epinephelus coioides). International Journal of Molecular Science. 2015, 16(11): 26137-50. PubMed ID: 26540042

This article reports that growth hormone releasing hormone (GHRH) and its receptor GHRHR are important components of the hypothalamic-pituitary growth axis and can act on growth hormone (GH).
Zeynep Şıklar., et al. Two Siblings with Isolated GH Deficiency Due to Loss-of-Function Mutation in the GHRHR Gene: Successful Treatment with Growth Hormone Despite Late Admission and Severe Growth Retardation. J Clin Res Pediatr Endocrinol. 2010, 2(4): 164-7. PubMed ID: 21274317

This article reveals that Sporadic growth hormone deficiency may be caused by environmental brain damage or dysplasia, GHRHR mutation patients and phenotype and biochemistry are indistinguishable from other forms of IGHD.
Latifa Hilal., et al. Unusual Phenotypic Features in a Patient with a Novel Splice Mutation in the GHRHR Gene. Molecular Medicine. 2008, 14(5-6): 286-92. PubMed ID: 18297129

The article reveals that the gene encoding GHRHR is involved in isolated growth hormone deficiency (IGHD), which plays a key role in GH synthesis and pituitary secretion through its ligand (GHRH).
Rosemeire M., et al. Activation of growth hormone releasing hormone (GHRH) receptor stimulates cardiac reverse remodeling after myocardial infarction (MI). PNAS. 2012, 109(2): 559-63. PubMed ID: 22203988

This article shows that Growth hormone releasing hormone (GHRH) receptors expressed by cardiomyocytes and cardiac stem cells (CSCs) are activated to improve the injury response after myocardial infarction (MI).
Luiza L., et al. Growth Hormone-Releasing Hormone Agonists Reduce Myocardial Infarct Scar in Swine With Subacute Ischemic Cardiomyopathy. J Am Heart Assoc. 2015, PubMed ID: 25827134

This article evaluates that Cardiac repair of growth hormone releasing hormone agonist (GHRH-As) after myocardial infarction (MI) in rats is regulated by activating GHRH signaling pathways in the heart.

GHRHR Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-GHRHR antibody development services.

As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: