Introduction of GIPR
The gastric inhibitory polypeptide receptor (GIPR) is a protein encoded by the GIPR gene in the human body and is also known as glucose-dependent insulinotropic polypeptide receptors. GIPR is a seven-transmembrane protein found on pancreatic beta cells. It was originally identified as an activity in intestinal extracts that inhibited gastric acid secretion and gastrin release but was subsequently shown to stimulate insulin release in the presence of elevated glucose.
| Basic Information of GIPR | |
| Protein Name | Gastric inhibitory polypeptide receptor |
| Gene Name | GIPR |
| Aliases | Glucose-dependent insulinotropic polypeptide receptor, PGQTL2 |
| Organism | Homo sapiens (Human) |
| UniProt ID | P48546 |
| Transmembrane Times | 7 |
| Length (aa) | 466 |
| Sequence |
MTTSPILQLLLRLSLCGLLLQRAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGS FDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFL DQRLILERLQVMYTVGYSLSLATLLLALLILSLFRRLHCTRNYIHINLFTSFMLRAAAILSRDR LLPRPGPYLGDQALALWNQALAACRTAQIVTQYCVGANYTWLLVEGVYLHSLLVLVGGSEEGHF RYYLLLGWGAPALFVIPWVIVRYLYENTQCWERNEVKAIWWIIRTPILMTILINFLIFIRILGI LLSKLRTRQMRCRDYRLRLARSTLTLVPLLGVHEVVFAPVTEEQARGALRFAKLGFEIFLSSFQ GFLVSVLYCFINKEVQSEIRRGWHHCRLRRSLGEEQRQLPERAFRALPSGSGPGEVPTSRGLSS GTLPGPGNEASRELESYC |
Function of GIPR Membrane Protein
GIPR is a receptor for gastric inhibitory polypeptides (GIPs), also known as glucose-dependent insulinotropic polypeptides, the activity of which is mediated by G proteins that activate adenylate cyclase. The main physiological role of GIPR is to promote insulin release from islet β cells. There are also some studies that suggest that GIPR plays a role in the regulation of locomotor activity and exploration, and that inhibition of GIP signaling is also an optional target for anti-obesity drugs.
Fig.1 Crystal structure of the extracellular domain of human GIP receptor in complex with the hormone GIP.
Application of GIPR Membrane Protein in Literature
This article reports that desensitization of GIP action is associated with a transient decrease in GIPR expression in the plasma membrane.
This article reveals that antagonizing glucose-dependent insulinotropic polypeptide (GIP) receptors play an important role in the treatment of diabetes and obesity.
The result of this article reveals that ectopic expression of the glucose-dependent insulinotropic polypeptide receptor (GIPR) causes GIP-dependent Cushing's syndrome.
It is shown herein that the incretin glucagon-like peptide-1 receptor (GLP-1R) is recycled back to the cell surface and desensitized.
This article evaluates that ectopic expression of the GIPR in the human adrenal gland induces hypercortisolemia and leads to Cushing's syndrome, which activates the secretion of adrenal glucocorticoids.
GIPR Preparation Options
To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-GIPR antibody development services.
As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.