Close

GIPR Membrane Protein Introduction

Introduction of GIPR

The gastric inhibitory polypeptide receptor (GIPR) is a protein encoded by the GIPR gene in the human body and is also known as glucose-dependent insulinotropic polypeptide receptors. GIPR is a seven-transmembrane protein found on pancreatic beta cells. It was originally identified as an activity in intestinal extracts that inhibited gastric acid secretion and gastrin release but was subsequently shown to stimulate insulin release in the presence of elevated glucose.

Basic Information of GIPR
Protein Name Gastric inhibitory polypeptide receptor
Gene Name GIPR
Aliases Glucose-dependent insulinotropic polypeptide receptor, PGQTL2
Organism Homo sapiens (Human)
UniProt ID P48546
Transmembrane Times 7
Length (aa) 466
Sequence MTTSPILQLLLRLSLCGLLLQRAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGS
FDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFL
DQRLILERLQVMYTVGYSLSLATLLLALLILSLFRRLHCTRNYIHINLFTSFMLRAAAILSRDR
LLPRPGPYLGDQALALWNQALAACRTAQIVTQYCVGANYTWLLVEGVYLHSLLVLVGGSEEGHF
RYYLLLGWGAPALFVIPWVIVRYLYENTQCWERNEVKAIWWIIRTPILMTILINFLIFIRILGI
LLSKLRTRQMRCRDYRLRLARSTLTLVPLLGVHEVVFAPVTEEQARGALRFAKLGFEIFLSSFQ
GFLVSVLYCFINKEVQSEIRRGWHHCRLRRSLGEEQRQLPERAFRALPSGSGPGEVPTSRGLSS
GTLPGPGNEASRELESYC

Function of GIPR Membrane Protein

GIPR is a receptor for gastric inhibitory polypeptides (GIPs), also known as glucose-dependent insulinotropic polypeptides, the activity of which is mediated by G proteins that activate adenylate cyclase. The main physiological role of GIPR is to promote insulin release from islet β cells. There are also some studies that suggest that GIPR plays a role in the regulation of locomotor activity and exploration, and that inhibition of GIP signaling is also an optional target for anti-obesity drugs.

GIPR Membrane Protein IntroductionFig.1 Crystal structure of the extracellular domain of human GIP receptor in complex with the hormone GIP.

Application of GIPR Membrane Protein in Literature

  1. Sameer Mohammad., et al. A Naturally Occurring GIP Receptor Variant Undergoes Enhanced Agonist-Induced Desensitization, Which Impairs GIP Control of Adipose Insulin Sensitivity. Molecular and Cellular Biology. 2014, 34(19):3618-29. PubMed ID: 25047836

    This article reports that desensitization of GIP action is associated with a transient decrease in GIPR expression in the plasma membrane.

  2. Könitzer J.D., et al. Generation of a highly diverse panel of antagonistic chicken monoclonal antibodies against the GIP receptor. MAbs. 2017, 9(3):536-549. PubMed ID: 28055305

    This article reveals that antagonizing glucose-dependent insulinotropic polypeptide (GIP) receptors play an important role in the treatment of diabetes and obesity.

  3. Anne-Lise Lecoq., et al. Adrenal GIPR expression and chromosome 19q13 microduplications in GIP-dependent Cushing’s syndrome. JCI Insight. 2017. PubMed ID: 28931750

    The result of this article reveals that ectopic expression of the glucose-dependent insulinotropic polypeptide receptor (GIPR) causes GIP-dependent Cushing's syndrome.

  4. Roed, S.N., et al. Functional Consequences of Glucagon-like Peptide-1 Receptor Cross-talk and Trafficking. J Biol Chem. 2015, 290(2):1233-43. PubMed ID: 25451942

    It is shown herein that the incretin glucagon-like peptide-1 receptor (GLP-1R) is recycled back to the cell surface and desensitized.

  5. Fujii H., et al. Marked Cortisol Production by Intracrine ACTH in GIP-Treated Cultured Adrenal Cells in Which the GIP Receptor Was Exogenously Introduced. PLoS One. 2014, 9(10): e110543. PubMed ID: 25334044

    This article evaluates that ectopic expression of the GIPR in the human adrenal gland induces hypercortisolemia and leads to Cushing's syndrome, which activates the secretion of adrenal glucocorticoids.

GIPR Preparation Options

To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-GIPR antibody development services.


As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.


All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us