Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of GLP1R
The glucagon-like peptide 1 receptor (GLP1R) is a receptor protein encoded by gene GLP1R. GLP1R consists of two domains, an extracellular (ECD) that binds the C-terminal helix of GLP-1, and a transmembrane (TMD) domain that binds the N-terminal region of GLP-1. It was found on beta cells of the pancreas and involved in the control of blood sugar level by enhancing insulin secretion. It also stimulates glucose-induced insulin secretion.
| Basic Information of GLP1R | |
| Protein Name | Glucagon-like peptide 1 receptor |
| Gene Name | GLP1R |
| Aliases | GLP-1-R |
| Organism | Homo sapiens (Human) |
| UniProt ID> | P43220 |
| Transmembrane Times | 7 |
| Length (aa) | 463 |
| Sequence |
MAGAPGPLRLALLLLGMVGRAGPRPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDL FCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPW RDLSECEESKRGERSSPEEQLLFLYIIYTVGYALSFSALVIASAILLGFRHLHCTRNYIH LNLFASFILRALSVFIKDAALKWMYSTAAQQHQWDGLLSYQDSLSCRLVFLLMQYCVAAN YYWLLVEGVYLYTLLAFSVLSEQWIFRLYVSIGWGVPLLFVVPWGIVKYLYEDEGCWTRN SNMNYWLIIRLPILFAIGVNFLIFVRVICIVVSKLKANLMCKTDIKCRLAKSTLTLIPLL GTHEVIFAFVMDEHARGTLRFIKLFTELSFTSFQGLMVAILYCFVNNEVQLEFRKSWERW RLEHLHIQRDSSMKPLKCPTSSLSSGATAGSSMYTATCQASCS |
Function of GLP1R Membrane Protein
GLP1R is a receptor protein found on beta cells of the pancreas. This receptor, which functions at the cell surface, becomes internalized in response to GLP-1 and GLP-1 analogs, and it plays an important role in the signaling cascades leading to insulin secretion. Activated GLP1R stimulates the adenylyl cyclase pathway which results in increased insulin synthesis and release of insulin. GLP1R, expressed in the brain, is involved in the control of appetite. GLP1R, expressed in stretch responsive vagal neurons in the stomach and intestinesneurons, innervates stomach muscle and can communicate with additional organ systems changing breathing and heart rate due to activation.
Fig.1 Structure of protein GLP1R.
Application of GLP1R Membrane Protein in Literature
This paper reports that glucose and body weight is regulated by the brain and the GLP1R mediator changes in neurons, but it is necessary for non-glucose reduction.
This paper proposes that glucagon-like peptide 1 (GLP-1) can mediate the global stress response in the hypothalamic paraventricular circulation.
This article reveals that improvement in renal fibrosis is mediated by exendin-4 via the miR-192-GLP1R pathway.
This article shows that functional disruption of the Glp1r results in exercise-induced hyperglycemia associated with an excessive increase in glucagon secretion and HGP. These results suggest an essential role for basal Glp1r signaling in the suppression of alpha cell secretion during exercise.
This article evaluates that glucagon-like peptide-1 (GLP-1) and glucose-dependent insulinotropic polypeptide (GIP) play important roles in insulin secretion through their receptors, GLP1R and GIPR.
GLP1R Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-GLP1R antibody development services.
As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
