0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant AKV murine leukemia virus Envelope glycoprotein (env) (32-470 aa) [His/Myc-Tag], E. coli (CAT#: GP02-032J)

Datasheet
SizeQtyAdd To Basket
100 μg
1 mg

Product Overview Recombinant AKV murine leukemia virus Envelope glycoprotein (32-470 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source E. coli
Species AKV murine leukemia virus
Fragment 32-470 aa
Sequence VTLGNSPHQVFNLTWEVTNGDRETVWAITGNHPLWTWWPDLTPDLCMLALHGPSYWGLEYRAPFSPPPGPPCCSGSSDSTPGCSRDCEEPLTSYTPRCNTAWNRLKLSKVTHAHNGGFYVCPGPHRPRWARSCGGPESFYCASWGCETTGRASWKPSSSWDYITVSNNLTSDQATPVCKGNEWCNSLTIRFTSFGKQATSWVTGHWWGLRLYVSGHDPGLIFGIRLKITDSGPRVPIGPNPVLSDRRPPSRPRPTRSPPPSNSTPTETPLTLPEPPPAGVENRLLNLVKGAYQALNLTSPDKTQECWLCLVSGPPYYEGVAVLGTYSNHTSAPANCSVASQHKLTLSEVTGQGLCIGAVPKTHQVLCNTTQKTSDGSYYLAAPTGTTWACSTGLTPCISTTILDLTTDYCVLVELWPRVTYHSPSYVYHQFERRAKYKR
Tag 10xHis-tag at the N-terminus and Myc-tag at the C-terminus
Predicted MW 53.3 kDa
Purity >95%, determined by SDS-PAGE.
Conjugation Unconjugated
Target env
Full Name Envelope glycoprotein
Uniprot ID P03386
Background The surface protein (SU) attaches the virus to the host cell by binding to its receptor. This interaction triggers the refolding of the transmembrane protein (TM) and is thought to activate its fusogenic potential by unmasking its fusion peptide. Fusion occurs at the host cell plasma membrane.
Alternate Names Env polyprotein
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
Close
Thanksgiving
Thanksgiving