Recombinant Bat coronavirus HKU3 Spike glycoprotein (S) (310-514 aa) [His-Tag], Baculovirus (CAT#: GP02-115J)

Product Overview	Recombinant Bat coronavirus HKU3 Spike glycoprotein (310-514 aa) was expressed in Baculovirus with a 6xHis-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	Baculovirus
Species	Bat coronavirus HKU3
Fragment	310-514 aa
Sequence	RVSPTQEVIRFPNITNRCPFDKVFNATRFPNVYAWERTKISDCVADYTVLYNSTSFSTFKCYGVSPSKLIDLCFTSVYADTFLIRSSEVRQVAPGETGVIADYNYKLPDDFTGCVIAWNTAKHDTGNYYYRSHRKTKLKPFERDLSSDDGNGVYTLSTYDFNPNVPVAYQATRVVVLSFELLNAPATVCGPKLSTELVKNQCVNF
Tag	6xHis-tag at the C-terminus
Predicted MW	24.3 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	S
Full Name	Spike glycoprotein
Uniprot ID	Q3LZX1
Background	Spike protein S1 attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. Spike protein S2 mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein.
Alternate Names	S glycoprotein; E19; Peplomer protein; S