0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Bat coronavirus HKU3 Spike glycoprotein (S) (310-514 aa) [His-Tag], Baculovirus (CAT#: GP02-115J)

Datasheet
SizeQtyAdd To Basket
100 μg
500 μg

Product Overview Recombinant Bat coronavirus HKU3 Spike glycoprotein (310-514 aa) was expressed in Baculovirus with a 6xHis-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source Baculovirus
Species Bat coronavirus HKU3
Fragment 310-514 aa
Sequence RVSPTQEVIRFPNITNRCPFDKVFNATRFPNVYAWERTKISDCVADYTVLYNSTSFSTFKCYGVSPSKLIDLCFTSVYADTFLIRSSEVRQVAPGETGVIADYNYKLPDDFTGCVIAWNTAKHDTGNYYYRSHRKTKLKPFERDLSSDDGNGVYTLSTYDFNPNVPVAYQATRVVVLSFELLNAPATVCGPKLSTELVKNQCVNF
Tag 6xHis-tag at the C-terminus
Predicted MW 24.3 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target S
Full Name Spike glycoprotein
Uniprot ID Q3LZX1
Background Spike protein S1 attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. Spike protein S2 mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein.
Alternate Names S glycoprotein; E19; Peplomer protein; S
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on