0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Bornean orangutan T-cell surface glycoprotein CD8 alpha chain (CD8A) (22-198 aa), E. coli (CAT#: GPX04-011J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Bornean orangutan T-cell surface glycoprotein CD8 alpha chain (22-198 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Bornean orangutan
Fragment 22-198 aa
Sequence SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGGKPSLSERYV
Tag His-tag or Tag free
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target CD8A
Full Name T-cell surface glycoprotein CD8 alpha chain
Uniprot ID P30433
Background Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs).
Alternate Names T-cell surface glycoprotein CD8 alpha chain
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on