Recombinant Bovine coronavirus (strain 98TXSF-110-LUN) Spike glycoprotein (S) (314-634 aa) [His-Tag], Mammalian cell (CAT#: GP02-102J)

Datasheet

Size	Qty	Add To Basket
100 μg
1 mg

Product Overview	Recombinant Bovine coronavirus (strain 98TXSF-110-LUN) Spike glycoprotein (314-634 aa) was expressed in Mammalian cell with a 6xHis-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	Mammalian cell
Species	Bovine coronavirus (strain 98TXSF-110-LUN)
Fragment	314-634 aa
Sequence	TVQPIADVYRRIPNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQSVFKPQPAGVFTDHDVVYAQHCFKAPTNFCPCKLDGSLCVGNGPGIDAGYKTSGIGTCPAGTNYLTCHNAAQCDCLCTPDPITSKATGPYKCPQTKYLVGIGEHCSGLAIKSDHCGGNPCTCQPQAFLGWSVDSCLQGDRCNIFANFILHDVNSGTTCSTDLQKSNTDIILGVCVNY
Tag	6xHis-tag at the C-terminus
Predicted MW	37.3 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	S
Full Name	Spike glycoprotein
Uniprot ID	Q8V436
Background	Spike protein S1 attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. Spike protein S2 mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein.
Alternate Names	S glycoprotein; E11; Peplomer protein; S

Recombinant SARS-CoV-2 Surface glycoprotein (S) (319-541 aa) (N501Y) [His-mFc-Tag], Mammalian cell (CAT#: GP02-130J)
Recombinant SARS-CoV-2 Surface glycoprotein (S) (319-541 aa) (W436R) [His-Tag], Mammalian cell (CAT#: GP02-135J)
Recombinant Human coronavirus HKU1 (isolate N5) Spike glycoprotein (S) (310-622 aa) [mFC-Tag], Mammalian cell (CAT#: GP02-113J)
Recombinant SARS-CoV-2 Surface glycoprotein RBD (Arg319-Phe541) [Flag tag], HEK293 (CAT#: GP05-053J)
Recombinant Avian infectious bronchitis virus (strain 6/82) (IBV) Spike glycoprotein (S), Baculovirus (CAT#: GPX-045-B-J)
Recombinant Betacoronavirus England 1 Spike glycoprotein (Tyr18-Lys1294) [His tag], HEK293 (CAT#: GP05-096J)
Recombinant Avian infectious bronchitis virus (strain D3896) (IBV) Spike glycoprotein (S), E. coli, Biotin conjugation (CAT#: GPX-173-EB-J)
Recombinant SARS-CoV Spike glycoprotein (S), Baculovirus (CAT#: GPX-330-B-J)

For Research Use Only.

Online Inquiry

Follow us on

Specifications