Recombinant Bovine coronavirus (strain OK-0514) Spike glycoprotein (S) (314-634 aa) [His-Tag], Mammalian cell (CAT#: GP02-103J)

Datasheet

Size	Qty	Add To Basket
100 μg
1 mg

Product Overview	Recombinant Bovine coronavirus (strain OK-0514) Spike glycoprotein (314-634 aa) was expressed in Mammalian cell with a 6xHis-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	Mammalian cell
Species	Bovine coronavirus (strain OK-0514)
Fragment	314-634 aa
Sequence	TVQPIADVYRRIPNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSIWNRRFGFTEQSVFKPQPAGVFTDHDVVYAQHCFKAPTNFCPCKLDGSLCVGSGSGIDAGYKNTGIGTCPAGTNYLTCHNAAQCGCLCTPDPITSKATGPYKCPQTKYLVGIGEHCSGLAIKSDYCGGNPCSCRPQAFLGWSVDSCLQGDRCNIFANFILHDVNSGTTCSTDLQKSNTDIILGVCVNY
Tag	6xHis-tag at the C-terminus
Predicted MW	37.2 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	S
Full Name	Spike glycoprotein
Uniprot ID	Q9QAQ8
Background	Spike protein S1 attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. Spike protein S2 mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein.
Alternate Names	S glycoprotein; E12; Peplomer protein; S

Recombinant Human Surface glycoprotein (S) (16-685 aa (N501Y, P681H)) [His-Tag], Mammalian cell (CAT#: GP02-120J)
Recombinant Human coronavirus NL63 (HCoV-NL63) Spike glycoprotein (S) (481-616 aa) [His-sumostar-Tag], Yeast (CAT#: GP02-116J)
Recombinant SARS-CoV-2 Surface glycoprotein (S) (319-541 aa) (W436R) [His-Tag], Mammalian cell (CAT#: GP02-135J)
Recombinant Bovine coronavirus (strain L9) Spike glycoprotein (S) (314-634 aa) [His-Tag], Yeast (CAT#: GP02-112J)
Recombinant Avian infectious bronchitis virus (strain UK/142/86) (IBV) Spike glycoprotein (S), Yeast (CAT#: GPX-262-Y-J)
Recombinant SARS-CoV-2 Surface glycoprotein (Val16-Lys1211) [His tag], HEK293, Alexa Fluor® 488 labelled (CAT#: GP05-077J)
Recombinant SARS-CoV Spike glycoprotein (S), E. coli, Biotin conjugation (CAT#: GPX-330-EB-J)
Recombinant Avian infectious bronchitis virus (strain 6/82) (IBV) Spike glycoprotein (S), Mammalian cell (CAT#: GPX-045-M-J)

For Research Use Only.

Online Inquiry

Follow us on

Specifications