0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Bovine respiratory syncytial virus (BRSV) (strain 4642) Major surface glycoprotein G (G) (1-263 aa), E. coli (CAT#: GPX04-038J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Bovine respiratory syncytial virus (BRSV) (strain 4642) Major surface glycoprotein G (1-263 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Bovine respiratory syncytial virus (BRSV) (strain 4642)
Fragment 1-263 aa
Sequence MSNHTHHPKFKTLKRAWKASKYFIVGLSCLYKFNLKSLVQTALTTLAMITLTSLVITAII YISVGNAKAKPTSKPTTQQTQQLQNHTPPPLTEHNYKSTHTSIQSTTLSQPPNIDTTSGT TYGHPTNRTQNRKIKSQSTPLATRKPPINPLGSNPPENHQDHNNSQTLPHVPCSTCEGNP ACSPLCQIELERAPSSAPTITLKKAPKPKTTKKPTKTTIYHRTSPEAKLQTKKIMVTPQQ GILSSPEHQTNQSTTQISQHTSI
Tag His-tag or Tag free
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target G
Full Name Major surface glycoprotein G
Uniprot ID O10684
Background Attaches the virion to the host cell membrane by interacting with heparan sulfate, initiating the infection. Unlike the other paramyxovirus attachment proteins, lacks both neuraminidase and hemagglutinating activities.
Alternate Names Attachment glycoprotein G; Membrane-bound glycoprotein;
mG
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on