Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain (CD8A) (26-189 aa) [6xHis-tag], Yeast (CAT#: GPX04-012J)

Product Overview	Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain (26-189 aa) was expressed in Yeast with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	Yeast
Species	Bovine
Fragment	26-189 aa
Sequence	LSFRMSPTQKETRLGEKVELQCELLQSGMATGCSWLRHIPGDDPRPTFLMYLSAQRVKLAEGLDPRHISGAKVSGTKFQLTLSSFLQEDQGYYFCSVVSNSILYFSNFVPVFLPAKPATTPAMRPSSAAPTSAPQTRSVSPRSEVCRTSAGSAVDTSRLDFACN
Tag	6xHis-tag at the N-terminus
Predicted MW	19.9 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	CD8A
Full Name	T-cell surface glycoprotein CD8 alpha chain
Uniprot ID	P31783
Background	Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs).
Alternate Names	T-cell surface glycoprotein CD8 alpha chain