Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain (CD8A) (26-189 aa) [6xHis-SUMO-tag], E. coli

Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain (26-189 aa) was expressed in E. coli with a 6xHis-SUMO-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.

Determined by its binding ability in a functional ELISA.

Bovine

26-189 aa

LSFRMSPTQKETRLGEKVELQCELLQSGMATGCSWLRHIPGDDPRPTFLMYLSAQRVKLAEGLDPRHISGAKVSGTKFQLTLSSFLQEDQGYYFCSVVSNSILYFSNFVPVFLPAKPATTPAMRPSSAAPTSAPQTRSVSPRSEVCRTSAGSAVDTSRLDFACN

6xHis-SUMO-tag at the N-terminus

33.9 kDa

>90%, determined by SDS-PAGE.

Unconjugated

CD8A

T-cell surface glycoprotein CD8 alpha chain

Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs).

T-cell surface glycoprotein CD8 alpha chain