There is no product in the shopping cart, buy it!
Size | Qty | Add To Basket |
---|---|---|
100 μg | ||
1 mg |
Product Overview | Recombinant Canine Glycoprotein hormones, alpha polypeptide (NP_001002988.1) (25-120 aa) was expressed in Yeast with a 10xHis-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
Source | Yeast |
Species | Canine |
Fragment | 25-120 aa |
Sequence | FPDGEFTMQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNAKVENHTECHCSTCYYHKS |
Tag | 10xHis-tag at the C-terminus |
Predicted MW | 12.7 kDa |
Purity | >95%, determined by SDS-PAGE. |
Conjugation | Unconjugated |
Target | CGA |
Full Name | Glycoprotein hormones, alpha polypeptide |
Gene ID | 403483 |
Uniprot ID | Q9XSW8 |
Accession Number | NP_001002988.1 |
Background | Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH and follitropin/follicle stimulating hormone/FSH. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways. |
Alternate Names | Anterior pituitary glycoprotein hormones common subunit alpha; Follicle-stimulating hormone alpha chain; FSH-alpha; Follitropin alpha chain; Luteinizing hormone alpha chain; LSH-alpha; Lutropin alpha chain; Thyroid-stimulating hormone alpha chain; TSH-alpha; Thyrotropin alpha chain |