There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 10 μg | ||
| 50 μg | ||
| 200 μg |
| Product Overview | Recombinant Canine Uromodulin (UMOD) protein (Arg32-Glu151) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
| Biological Activity | Determined by its binding ability in a functional ELISA. |
| Source | E. coli |
| Species | Canine |
| Fragment | Arg32-Glu151 |
| Sequence | MGHHHHHHSGSRSCSECHSNATCMEDGMVTTCSCLVGFTGSGFECVDLDECAIPGAHNCSEGSSCMNTLGSYLCTCPDGFRLTPGLGCIDVDECSEPGLSRCHALATCINNKGNYSCVCPAGYRGDGQHCE |
| Tag | His-Tag at the N-terminus |
| Predicted MW | 13.8 KDa |
| Purity | >95%, determined by SDS-PAGE and HPLC |
| Endotoxin Level | <1 EU/μg, determined by the LAL method |
| Conjugation | Unconjugated |
| Target | UMOD |
| Full Name | Uromodulin |
| Uniprot ID | Q862Z3 |
| Background | This protein functions in biogenesis and organization of the apical membrane of epithelial cells of the thick ascending limb of Henle's loop (TALH), where it promotes formation of complex filamentous gel-like structure that may play a role in the water barrier permeability. May serve as a receptor for binding and endocytosis of cytokines (IL-1, IL-2) and TNF. Facilitates neutrophil migration across renal epithelia. |
| Alternate Names | Tamm-Horsfall urinary glycoprotein; THP; UMOD; Uromodulin |