0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Canine Uromodulin (UMOD) protein [His-Tag], E. coli (CAT#: GP01-126J)

Datasheet
SizeQtyAdd To Basket
10 μg
50 μg
200 μg

Product Overview Recombinant Canine Uromodulin (UMOD) protein (Arg32-Glu151) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Canine
Fragment Arg32-Glu151
Sequence MGHHHHHHSGSRSCSECHSNATCMEDGMVTTCSCLVGFTGSGFECVDLDECAIPGAHNCSEGSSCMNTLGSYLCTCPDGFRLTPGLGCIDVDECSEPGLSRCHALATCINNKGNYSCVCPAGYRGDGQHCE
Tag His-Tag at the N-terminus
Predicted MW 13.8 KDa
Purity >95%, determined by SDS-PAGE and HPLC
Endotoxin Level <1 EU/μg, determined by the LAL method
Conjugation Unconjugated
Target UMOD
Full Name Uromodulin
Uniprot ID Q862Z3
Background This protein functions in biogenesis and organization of the apical membrane of epithelial cells of the thick ascending limb of Henle's loop (TALH), where it promotes formation of complex filamentous gel-like structure that may play a role in the water barrier permeability. May serve as a receptor for binding and endocytosis of cytokines (IL-1, IL-2) and TNF. Facilitates neutrophil migration across renal epithelia.
Alternate Names Tamm-Horsfall urinary glycoprotein; THP; UMOD; Uromodulin
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
Close
Thanksgiving
Thanksgiving