Recombinant Canine Uromodulin (UMOD) protein [His-Tag], E. coli (CAT#: GP01-126J)

Product Overview	Recombinant Canine Uromodulin (UMOD) protein (Arg32-Glu151) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Canine
Fragment	Arg32-Glu151
Sequence	MGHHHHHHSGSRSCSECHSNATCMEDGMVTTCSCLVGFTGSGFECVDLDECAIPGAHNCSEGSSCMNTLGSYLCTCPDGFRLTPGLGCIDVDECSEPGLSRCHALATCINNKGNYSCVCPAGYRGDGQHCE
Tag	His-Tag at the N-terminus
Predicted MW	13.8 KDa
Purity	>95%, determined by SDS-PAGE and HPLC
Endotoxin Level	<1 EU/μg, determined by the LAL method
Conjugation	Unconjugated

Target	UMOD
Full Name	Uromodulin
Uniprot ID	Q862Z3
Background	This protein functions in biogenesis and organization of the apical membrane of epithelial cells of the thick ascending limb of Henle's loop (TALH), where it promotes formation of complex filamentous gel-like structure that may play a role in the water barrier permeability. May serve as a receptor for binding and endocytosis of cytokines (IL-1, IL-2) and TNF. Facilitates neutrophil migration across renal epithelia.
Alternate Names	Tamm-Horsfall urinary glycoprotein; THP; UMOD; Uromodulin