Recombinant Dog T-cell surface glycoprotein CD8 alpha chain (CD8A) (22-239 aa), E. coli (CAT#: GPX04-076J)

Product Overview	Recombinant Dog T-cell surface glycoprotein CD8 alpha chain (22-239 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Dog
Fragment	22-239 aa
Sequence	SGPSRFRMTPPKVVGQLHAQVELQCQVLLSTAAPGCSWLYQRNEPAARPVFLMYISQSRAKPAEGLDTKHISGQKKTDSTYSLTLSRFRKEDEGYYFCSVLSNSILYFSPFVPVFLPVKPPTTPAPRPPTRAPTNASKPVSPRGETCRPAAGSAVKTSGLDFACEIYIWAPLAGTCAVLLLSLVITIICNHRNRRRVCKCPRPVVRPGGKPSPSEKYV
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	CD8A
Full Name	T-cell surface glycoprotein CD8 alpha chain
Uniprot ID	P33706
Background	Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs).
Alternate Names	T-cell surface glycoprotein CD8 alpha chain