Recombinant Friend spleen focus-forming virus (FSFFV) Glycoprotein 55 (Env) (33-409 aa) [His-tag], E. coli (CAT#: GP03-070J)

Product Overview	Recombinant Friend spleen focus-forming virus (FSFFV) Glycoprotein 55 (33-409 aa) was expressed in E. coli with a His-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Friend spleen focus-forming virus (FSFFV)
Fragment	33-409 aa
Sequence	VQLDSPHQVSNVTWRVTNLMTGQTANATSLLGTMTEAFPKLYFDLCDL mgDDWDETGLGCRTPGGRKRARTFDFYVCPGHTVPTGCGGPREGYCGKWGCETTGQAYWKPSSSWDLISLKRGNTPKDQGPCYDSSVSSGVLGATPGGRCNPLVLEFTDAGRKASWDAPKVWGLRLYRSTGTDPVTRFSLTRQVLDIGPRVPIGSNPVTTDQLPLSRPVQTMPPRPLQPPPPGAASIVPETAPPPQQPGAGDRLLNLVDGAYQALNLTNPDKIQECWLCLVSGPPYYEGVVVLGTYFNHTIALKEKCCFYADHTGLVRDSMAKLRKRLTQRQKLFESSRGWFEGSSNRSPWFTTLISAI mgSLIILLLLLILLIWTLYS
Tag	His-tag at the N-terminus
Predicted MW	43.5 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	Env
Full Name	Glycoprotein 55
Uniprot ID	P03394
Background	This envelope-like membrane glycoprotein is responsible for ligand-independent activation of the erythropoietin receptor EPOR leading to the abnormally rapid proliferation of erythroid precursor cells.
Alternate Names	gp55; Glycoprotein 55