0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Friend spleen focus-forming virus (FSFFV) Glycoprotein 55 (Env) (33-409 aa) [His-tag], E. coli (CAT#: GP03-070J)

Datasheet
SizeQtyAdd To Basket
100 μg
500 μg
1 mg

Product Overview Recombinant Friend spleen focus-forming virus (FSFFV) Glycoprotein 55 (33-409 aa) was expressed in E. coli with a His-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Friend spleen focus-forming virus (FSFFV)
Fragment 33-409 aa
Sequence VQLDSPHQVSNVTWRVTNLMTGQTANATSLLGTMTEAFPKLYFDLCDL mgDDWDETGLGCRTPGGRKRARTFDFYVCPGHTVPTGCGGPREGYCGKWGCETTGQAYWKPSSSWDLISLKRGNTPKDQGPCYDSSVSSGVLGATPGGRCNPLVLEFTDAGRKASWDAPKVWGLRLYRSTGTDPVTRFSLTRQVLDIGPRVPIGSNPVTTDQLPLSRPVQTMPPRPLQPPPPGAASIVPETAPPPQQPGAGDRLLNLVDGAYQALNLTNPDKIQECWLCLVSGPPYYEGVVVLGTYFNHTIALKEKCCFYADHTGLVRDSMAKLRKRLTQRQKLFESSRGWFEGSSNRSPWFTTLISAI mgSLIILLLLLILLIWTLYS
Tag His-tag at the N-terminus
Predicted MW 43.5 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target Env
Full Name Glycoprotein 55
Uniprot ID P03394
Background This envelope-like membrane glycoprotein is responsible for ligand-independent activation of the erythropoietin receptor EPOR leading to the abnormally rapid proliferation of erythroid precursor cells.
Alternate Names gp55; Glycoprotein 55
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on