There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 100 μg |
| Product Overview | Recombinant Human ATP binding cassette subfamily B member 1 (NP_000918.2) (236-297 aa) was expressed in E. coli with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
| Source | E. coli |
| Species | Human |
| Fragment | 236-297 aa |
| Sequence | LSSFTDKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANI |
| Tag | 6xHis-tag at the N-terminus |
| Predicted MW | 10.8 kDa |
| Purity | >95%, determined by SDS-PAGE. |
| Conjugation | Unconjugated |
| Target | ABCB1 |
| Full Name | ATP binding cassette subfamily B member 1 |
| Gene ID | 5243 |
| Uniprot ID | P08183 |
| Accession Number | NP_000918.2 |
| Background | The protein is an ATP-dependent drug efflux pump for xenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. |
| Alternate Names | CLCS; MDR1; P-GP; PGY1; ABC20; CD243; GP170; p-170 |