There is no product in the shopping cart, buy it!
Size | Qty | Add To Basket |
---|---|---|
100 μg |
Product Overview | Recombinant Human ATP binding cassette subfamily B member 1 (NP_000918.2) (236-297 aa) was expressed in E. coli with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
Source | E. coli |
Species | Human |
Fragment | 236-297 aa |
Sequence | LSSFTDKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANI |
Tag | 6xHis-tag at the N-terminus |
Predicted MW | 10.8 kDa |
Purity | >95%, determined by SDS-PAGE. |
Conjugation | Unconjugated |
Target | ABCB1 |
Full Name | ATP binding cassette subfamily B member 1 |
Gene ID | 5243 |
Uniprot ID | P08183 |
Accession Number | NP_000918.2 |
Background | The protein is an ATP-dependent drug efflux pump for xenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. |
Alternate Names | CLCS; MDR1; P-GP; PGY1; ABC20; CD243; GP170; p-170 |