0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human ATP binding cassette subfamily B member 1 (ABCB1) (236-297 aa) [His-Tag], E. coli (CAT#: GP02-001J)

Datasheet
SizeQtyAdd To Basket
100 μg

Product Overview Recombinant Human ATP binding cassette subfamily B member 1 (NP_000918.2) (236-297 aa) was expressed in E. coli with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source E. coli
Species Human
Fragment 236-297 aa
Sequence LSSFTDKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANI
Tag 6xHis-tag at the N-terminus
Predicted MW 10.8 kDa
Purity >95%, determined by SDS-PAGE.
Conjugation Unconjugated
Target ABCB1
Full Name ATP binding cassette subfamily B member 1
Gene ID 5243
Uniprot ID P08183
Accession Number NP_000918.2
Background The protein is an ATP-dependent drug efflux pump for xenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs.
Alternate Names CLCS; MDR1; P-GP; PGY1; ABC20; CD243; GP170; p-170
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on