There is no product in the shopping cart, buy it!
Size | Qty | Add To Basket |
---|---|---|
100 μg |
Product Overview | Recombinant Human Atypical chemokine receptor 1 (NP_002027.2) (1-336 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. Immobilized ACKR1 at 3 μg/mL can bind human CCL2, the EC50 of human CCL2 protein is 35 μg/mL. This product can be used in ELISA, WB, IP. |
Biological Activity | Determined by its binding ability to human CCL2 in a functional ELISA. Immobilized ACKR1 at 3 μg/mL can bind human CCL2, the EC50 of human CCL2 protein is 35 μg/mL. |
Source | E. coli |
Species | Human |
Fragment | 1-336 aa |
Sequence | MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS |
Tag | 10xHis-tag at the N-terminus |
Predicted MW | 41.1 kDa |
Purity | >90%, determined by SDS-PAGE. |
Conjugation | Unconjugated |
Target | ACKR1 |
Full Name | Atypical chemokine receptor 1 |
Gene ID | 2532 |
Uniprot ID | Q16570 |
Accession Number | NP_002027.2 |
Background | This protein is an atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. |
Alternate Names | FY; Dfy; GPD; DARC; GpFy; CCBP1; CD234; WBCQ1; DARC/ACKR1 |