0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human Atypical chemokine receptor 1 (ACKR1) (1-336 aa) [His-Tag], E. coli (CAT#: GP02-003J)

Datasheet
SizeQtyAdd To Basket
100 μg

Product Overview Recombinant Human Atypical chemokine receptor 1 (NP_002027.2) (1-336 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. Immobilized ACKR1 at 3 μg/mL can bind human CCL2, the EC50 of human CCL2 protein is 35 μg/mL. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability to human CCL2 in a functional ELISA. Immobilized ACKR1 at 3 μg/mL can bind human CCL2, the EC50 of human CCL2 protein is 35 μg/mL.
Source E. coli
Species Human
Fragment 1-336 aa
Sequence MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS
Tag 10xHis-tag at the N-terminus
Predicted MW 41.1 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target ACKR1
Full Name Atypical chemokine receptor 1
Gene ID 2532
Uniprot ID Q16570
Accession Number NP_002027.2
Background This protein is an atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis.
Alternate Names FY; Dfy; GPD; DARC; GpFy; CCBP1; CD234; WBCQ1; DARC/ACKR1
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on