Recombinant Human Atypical chemokine receptor 1 (ACKR1) (1-336 aa) [His-Tag], E. coli (CAT#: GP02-003J)

Name: Recombinant Human Atypical chemokine receptor 1 (ACKR1) (1-336 aa) [His-Tag], E. coli
SKU: GP02-003J
Rating: 5 (1 reviews)

Datasheet

Size	Qty	Add To Basket
100 μg

Product Overview	Recombinant Human Atypical chemokine receptor 1 (NP_002027.2) (1-336 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. Immobilized ACKR1 at 3 μg/mL can bind human CCL2, the EC50 of human CCL2 protein is 35 μg/mL. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability to human CCL2 in a functional ELISA. Immobilized ACKR1 at 3 μg/mL can bind human CCL2, the EC50 of human CCL2 protein is 35 μg/mL.
Source	E. coli
Species	Human
Fragment	1-336 aa
Sequence	MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS
Tag	10xHis-tag at the N-terminus
Predicted MW	41.1 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	ACKR1
Full Name	Atypical chemokine receptor 1
Gene ID	2532
Uniprot ID	Q16570
Accession Number	NP_002027.2
Background	This protein is an atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis.
Alternate Names	FY; Dfy; GPD; DARC; GpFy; CCBP1; CD234; WBCQ1; DARC/ACKR1

For Research Use Only.

Online Inquiry

Follow us on

Specifications