0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human betacoronavirus 2c EMC/2012 Spike glycoprotein (S glycoprotein) (367-606 aa) [His-sumostar-Tag], Yeast (CAT#: GP02-142J)

Datasheet
SizeQtyAdd To Basket
100 μg
1 mg

Product Overview Recombinant Human betacoronavirus 2c EMC/2012 Spike glycoprotein (367-606 aa) was expressed in Yeast with a 6xHis-sumostar-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source Yeast
Species Human betacoronavirus 2c EMC/2012
Fragment 367-606 aa
Sequence EAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEY
Tag 6xHis-sumostar-tag at the N-terminus
Predicted MW 40.2 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target S glycoprotein
Full Name Spike glycoprotein
Uniprot ID K0BRG7
Background Spike protein S1 attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. Spike protein S2 acts as a viral fusion peptide which is unmasked following S2 cleavage occurring upon virus endocytosis.
Alternate Names E2; Peplomer protein
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on