There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 100 μg | ||
| 1 mg |
| Product Overview | Recombinant Human betacoronavirus 2c EMC/2012 Spike glycoprotein (367-606 aa) was expressed in Yeast with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
| Source | Yeast |
| Species | Human betacoronavirus 2c EMC/2012 |
| Fragment | 367-606 aa |
| Sequence | EAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEY |
| Tag | 6xHis-tag at the N-terminus |
| Predicted MW | 28.3 kDa |
| Purity | >95%, determined by SDS-PAGE. |
| Conjugation | Unconjugated |
| Target | S glycoprotein |
| Full Name | Spike glycoprotein |
| Uniprot ID | K0BRG7 |
| Background | Spike protein S1 attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. Spike protein S2 acts as a viral fusion peptide which is unmasked following S2 cleavage occurring upon virus endocytosis. |
| Alternate Names | E2; Peplomer protein |