Recombinant Human CD59 glycoprotein (CD59) (26-102 aa) [GST-tag], E. coli (CAT#: GPX04-133J)

Product Overview	Recombinant Human CD59 glycoprotein (NP_000602.1) (26-102 aa) was expressed in E. coli with a GST-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Human
Fragment	26-102 aa
Sequence	LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
Tag	GST-tag at the N-terminus
Predicted MW	36.0 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	CD59
Full Name	CD59 glycoprotein
Gene ID	966
Uniprot ID	P13987
Accession Number	NP_000602.1
Background	Potent inhibitor of the complement membrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complements of the assembling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.
Alternate Names	1F5 antigen; 20 kDa homologous restriction factor; MAC-inhibitory protein; MEM43 antigen; Membrane attack complex inhibition factor