Recombinant Human coronavirus NL63 (HCoV-NL63) Membrane protein (M) (1-226 aa) [His-tag], E. coli (CAT#: GP02-070J)

Product Overview	Recombinant Human coronavirus NL63 (HCoV-NL63) Membrane protein (1-226 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	E. coli
Species	Human coronavirus NL63 (HCoV-NL63)
Fragment	1-226 aa
Sequence	MSNSSVPLLEVYVHLRNWNFSWNLILTLFIVVLQYGHYKYSRLLYGLKMSVLWCLWPLVLALSIFDCFVNFNVDWVFFGFSILMSIITLCLWVMYFVNSFRLWRRVKTFWAFNPETNAIISLQVYGHNYYLPVMAAPTGVTLTLLSGVLLVDGHKIATRVQVGQLPKYVIVATPSTTIVCDRVGRSVNETSQTGWAFYVRAKHGDFSGVASQEGVLSEREKLLHLI
Tag	10xHis-tag at the N-terminus
Predicted MW	28.7 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	M
Full Name	Membrane protein
Gene ID	2943503
Uniprot ID	Q6Q1R9
Background	This protein is a component of the viral envelope that plays a central role in virus morphogenesis and assembly via its interactions with other viral proteins.
Alternate Names	E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein