0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human Endo-beta-N-acetylglucosaminidase (ENGASE) (1-377 aa) [His-SUMO], E. coli (CAT#: GP02-031J)

Datasheet
SizeQtyAdd To Basket
100 μg
1 mg

Product Overview Recombinant Human Endo-beta-N-acetylglucosaminidase (NP_001036038.1) (1-377 aa) was expressed in E. coli with a 6xHis-SUMO-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source E. coli
Species Human
Fragment 1-377 aa
Sequence MEAAAVTVTRSATRRRRRQLQGLAAPEAGTQEEQEDQEPRPRRRRPGRSIKDEEEETVFREVVSFSPDPLPVRYYDKDTTKPISFYLSSLEELLAWKPRLEDGFNVALEPLACRQPPLSSQRPRTLLCHDMMGGYLDDRFIQGSVVQTPYAFYHWQCIDVFVYFSHHTVTIPPVGWTNTAHRHGVCVLGTFITEWNEGGRLCEAFLAGDERSYQAVADRLVQITQFFRFDGWLINIENSLSLAAVGNMPPFLRYLTTQLHRQVPGGLVLWYDSVVQSGQLKWQDELNQHNRVFFDSCDGFFTNYNWREEHLERMLGQAGERRADVYVGVDVFARGNVVGGRFDTDKSLELIRKHGFSVALFAPSCSVFPGVGNLLCC
Tag 6xHis-SUMO-tag at the N-terminus
Predicted MW 59.1 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target ENGASE
Full Name Endo-beta-N-acetylglucosaminidase
Gene ID 64772
Uniprot ID Q8NFI3
Accession Number NP_001036038.1
Background This protein is a cytosolic enzyme which catalyzes the hydrolysis of peptides and proteins with mannose modifications to produce free oligosaccharides.
Alternate Names ENGase; Cytosolic endo-beta-N-acetylglucosaminidase
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
  • ()
    ()
    ()
ISO 9001 Certified - Creative Biolabs Quality Management System.