Recombinant Human Glycoprotein Ib platelet subunit beta (GP1BB) (26-206 aa) [His-SUMO/Myc-Tag], E. coli (CAT#: GP02-055J)

Product Overview	Recombinant Human Glycoprotein Ib platelet subunit beta (NP_000398.1) (26-206 aa) was expressed in E. coli with a 10xHis-SUMO-tag at the N-terminus and a a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	E. coli
Species	Human
Fragment	26-206 aa
Sequence	CPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLCWGALAAQLALLGLGLLHALLLVLLLCRLRRLRARARARAAARLSLTDPLVAERAGTDES
Tag	10xHis-SUMO-tag at the N-terminus and Myc-tag at the C-terminus
Predicted MW	39.3 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	GP1BB
Full Name	Glycoprotein Ib platelet subunit beta
Gene ID	2812
Uniprot ID	P13224
Accession Number	NP_000398.1
Background	Platelet glycoprotein Ib (GPIb) is a heterodimeric transmembrane protein consisting of a disulfide-linked 140 kD alpha chain and 22 kD beta chain. It is part of the GPIb-V-IX system that constitutes the receptor for von Willebrand factor (VWF), and mediates platelet adhesion in the arterial circulation. GPIb alpha chain provides the VWF binding site, and GPIb beta contributes to surface expression of the receptor and participates in transmembrane signaling through phosphorylation of its intracellular domain.
Alternate Names	BS; CD42C; GPIBB; BDPLT1; GPIbbeta