0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human Glycoprotein Ib platelet subunit beta (GP1BB) (26-206 aa) [His-SUMO/Myc-Tag], E. coli (CAT#: GP02-055J)

Datasheet
SizeQtyAdd To Basket
100 μg

Product Overview Recombinant Human Glycoprotein Ib platelet subunit beta (NP_000398.1) (26-206 aa) was expressed in E. coli with a 10xHis-SUMO-tag at the N-terminus and a a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source E. coli
Species Human
Fragment 26-206 aa
Sequence CPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLCWGALAAQLALLGLGLLHALLLVLLLCRLRRLRARARARAAARLSLTDPLVAERAGTDES
Tag 10xHis-SUMO-tag at the N-terminus and Myc-tag at the C-terminus
Predicted MW 39.3 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target GP1BB
Full Name Glycoprotein Ib platelet subunit beta
Gene ID 2812
Uniprot ID P13224
Accession Number NP_000398.1
Background Platelet glycoprotein Ib (GPIb) is a heterodimeric transmembrane protein consisting of a disulfide-linked 140 kD alpha chain and 22 kD beta chain. It is part of the GPIb-V-IX system that constitutes the receptor for von Willebrand factor (VWF), and mediates platelet adhesion in the arterial circulation. GPIb alpha chain provides the VWF binding site, and GPIb beta contributes to surface expression of the receptor and participates in transmembrane signaling through phosphorylation of its intracellular domain.
Alternate Names BS; CD42C; GPIBB; BDPLT1; GPIbbeta
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on