0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human herpesvirus 6B (strain Z29) Spliced envelope glycoprotein (U100) (25-354 aa) [His/Myc-Tag], E. coli (CAT#: GP02-153J)

Datasheet
SizeQtyAdd To Basket
100 μg
1 mg

Product Overview Recombinant Human herpesvirus 6B (strain Z29)Spliced envelope glycoprotein (25-354 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source E. coli
Species Human herpesvirus 6B (strain Z29)
Fragment 25-354 aa
Sequence TVHRDAGTVESTPPPDDEDNYTAKYYDDSIYFNIYDGTNPTPRRRTLPEIISKFSTSEMSRLGGLKAFVPVDYTPTTTLEDIEDLLNYAICDDNSCGCLIETEARSMFGDIIICVPLSAESRGVRNLKSRIMPMGLSQILSSGLGLHFSLLYGAFGSNYNSLAYMERLKPLTAMTAIAFCPMTSKLELRQNYRLEKARSNLIVNIELLKIQNHGGQTIKTLTSFAIVRKDSDGQDWETCTRFASVSIEDILRSKPAANGTCCPPRDVHHDRPTLQSSNSWTRTEYFEPWQDVVDAYVPINDNHCPNDSYVVFQTLQGHEWCSRLNKNDTK
Tag 10xHis-tag at the N-terminus and Myc-tag at the C-terminus
Predicted MW 44.6 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target U100
Full Name Spliced envelope glycoprotein
Gene ID 1497092
Uniprot ID Q9QJ11
Background This protein plays a role in virus entry by participating in host receptor binding at the cell surface.
Alternate Names gQ1; Glycoprotein 105
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
  • ()
    ()
    ()
ISO 9001 Certified - Creative Biolabs Quality Management System.