Recombinant Human herpesvirus 6B (strain Z29) Spliced envelope glycoprotein (U100) (25-354 aa) [His/Myc-Tag], E. coli

Recombinant Human herpesvirus 6B (strain Z29)Spliced envelope glycoprotein (25-354 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.

Human herpesvirus 6B (strain Z29)

25-354 aa

TVHRDAGTVESTPPPDDEDNYTAKYYDDSIYFNIYDGTNPTPRRRTLPEIISKFSTSEMSRLGGLKAFVPVDYTPTTTLEDIEDLLNYAICDDNSCGCLIETEARSMFGDIIICVPLSAESRGVRNLKSRIMPMGLSQILSSGLGLHFSLLYGAFGSNYNSLAYMERLKPLTAMTAIAFCPMTSKLELRQNYRLEKARSNLIVNIELLKIQNHGGQTIKTLTSFAIVRKDSDGQDWETCTRFASVSIEDILRSKPAANGTCCPPRDVHHDRPTLQSSNSWTRTEYFEPWQDVVDAYVPINDNHCPNDSYVVFQTLQGHEWCSRLNKNDTK

10xHis-tag at the N-terminus and Myc-tag at the C-terminus

44.6 kDa

>90%, determined by SDS-PAGE.

Unconjugated

U100

Spliced envelope glycoprotein

This protein plays a role in virus entry by participating in host receptor binding at the cell surface.

gQ1; Glycoprotein 105