0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human Inter-alpha-trypsin inhibitor heavy chain 4 (ITIH4) (689-930 aa) [His-SUMO], E. coli (CAT#: GP02-066J)

Datasheet
SizeQtyAdd To Basket
100 μg
1 mg

Product Overview Recombinant Human Inter-alpha-trypsin inhibitor heavy chain 4 (NP_002209.2) (689-930 aa) was expressed in E. coli with a 6xHis-SUMO-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source E. coli
Species Human
Fragment 689-930 aa
Sequence RLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVEL
Tag 6xHis-SUMO-tag at the N-terminus
Predicted MW 42.9 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target ITIH4
Full Name Inter-alpha-trypsin inhibitor heavy chain 4
Gene ID 3700
Uniprot ID Q14624
Accession Number NP_002209.2
Background The protein is secreted into the blood, where it is cleaved by plasma kallikrein into two smaller forms. This protein has been detected only in liver, and it seems to be upregulated during surgical trauma.
Alternate Names H4P; IHRP; GP120; PK120; ITIHL1; PK-120; ITI-HC4
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on