Recombinant Human Inter-alpha-trypsin inhibitor heavy chain 4 (ITIH4) (689-930 aa) [His-SUMO], E. coli (CAT#: GP02-066J)

Product Overview	Recombinant Human Inter-alpha-trypsin inhibitor heavy chain 4 (NP_002209.2) (689-930 aa) was expressed in E. coli with a 6xHis-SUMO-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	E. coli
Species	Human
Fragment	689-930 aa
Sequence	RLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVEL
Tag	6xHis-SUMO-tag at the N-terminus
Predicted MW	42.9 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	ITIH4
Full Name	Inter-alpha-trypsin inhibitor heavy chain 4
Gene ID	3700
Uniprot ID	Q14624
Accession Number	NP_002209.2
Background	The protein is secreted into the blood, where it is cleaved by plasma kallikrein into two smaller forms. This protein has been detected only in liver, and it seems to be upregulated during surgical trauma.
Alternate Names	H4P; IHRP; GP120; PK120; ITIHL1; PK-120; ITI-HC4