0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human Platelet glycoprotein Ib alpha chain (GP1BA) (553-652 aa) [10xHis-tag and Myc-tag], E. coli (CAT#: GPX04-126J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant HumanPlatelet glycoprotein Ib alpha chain (553-652 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Human
Fragment 553-652 aa
Sequence SWVGHVKPQALDSGQGAALTTATQTTHLELQRGRQVTVPRAWLLFLRGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYSGHSL
Tag 10xHis-tag at the N-terminus and Myc-tag at the C-terminus
Predicted MW 15.9 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target GP1BA
Full Name Platelet glycoprotein Ib alpha chain
Gene ID 2811
Uniprot ID P07359
Background GP-Ib, a surface membrane protein of platelets, participates in the formation of platelet plugs by binding to the A1 domain of vWF, which is already bound to the subendothelium.
Alternate Names GP1BA
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on