Recombinant Human Platelet glycoprotein Ib alpha chain (GP1BA) (553-652 aa) [10xHis-tag and Myc-tag], E. coli (CAT#: GPX04-126J)

Product Overview	Recombinant HumanPlatelet glycoprotein Ib alpha chain (553-652 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Human
Fragment	553-652 aa
Sequence	SWVGHVKPQALDSGQGAALTTATQTTHLELQRGRQVTVPRAWLLFLRGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYSGHSL
Tag	10xHis-tag at the N-terminus and Myc-tag at the C-terminus
Predicted MW	15.9 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	GP1BA
Full Name	Platelet glycoprotein Ib alpha chain
Gene ID	2811
Uniprot ID	P07359
Background	GP-Ib, a surface membrane protein of platelets, participates in the formation of platelet plugs by binding to the A1 domain of vWF, which is already bound to the subendothelium.
Alternate Names	GP1BA