Recombinant Human SARS coronavirus (SARS-CoV) Spike glycoprotein (S) (306-527 aa) [His/Myc-Tag], Mammalian cell

Recombinant Human SARS coronavirus (SARS-CoV) Spike glycoprotein (306-527 aa) was expressed in Mammalian cell with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 3 μg/mL can bind human ACE2, the EC50 is 8.41 ng/mL. This product can be used in ELISA, WB, IP.

Determined by its binding ability to human ACE2 in a functional ELISA. Immobilized SARS-CoV S-RBD at 3 μg/mL can bind human ACE2, the EC50 is 8.41 ng/mL.

Mammalian cell

Human SARS coronavirus (SARS-CoV)

306-527 aa

RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF

10xHis-tag at the N-terminus and Myc-tag at the C-terminus

30 kDa

>95%, determined by SDS-PAGE.

<1.0 EU/μg, determined by the LAL method.

Unconjugated

S

Spike glycoprotein

Spike protein S1 attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. Spike protein S2 mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein.

S glycoprotein; E2; Peplomer protein