There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 100 μg | ||
| 1 mg |
| Product Overview | Recombinant Human SARS coronavirus (SARS-CoV) Spike glycoprotein (306-527 aa) was expressed in Mammalian cell with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 3 μg/mL can bind human ACE2, the EC50 is 8.41 ng/mL. This product can be used in ELISA, WB, IP. |
| Biological Activity | Determined by its binding ability to human ACE2 in a functional ELISA. Immobilized SARS-CoV S-RBD at 3 μg/mL can bind human ACE2, the EC50 is 8.41 ng/mL. |
| Source | Mammalian cell |
| Species | Human SARS coronavirus (SARS-CoV) |
| Fragment | 306-527 aa |
| Sequence | RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF |
| Tag | 10xHis-tag at the N-terminus and Myc-tag at the C-terminus |
| Predicted MW | 30 kDa |
| Purity | >95%, determined by SDS-PAGE. |
| Endotoxin Level | <1.0 EU/μg, determined by the LAL method. |
| Conjugation | Unconjugated |
| Target | S |
| Full Name | Spike glycoprotein |
| Uniprot ID | P59594 |
| Background | Spike protein S1 attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. Spike protein S2 mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein. |
| Alternate Names | S glycoprotein; E2; Peplomer protein |