Recombinant Human SARS coronavirus (SARS-CoV) Spike glycoprotein (S) (306-527 aa) [His/Myc-Tag], Mammalian cell (CAT#: GP02-117J)

Product Overview	Recombinant Human SARS coronavirus (SARS-CoV) Spike glycoprotein (306-527 aa) was expressed in Mammalian cell with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. Immobilized SARS-CoV S-RBD at 3 μg/mL can bind human ACE2, the EC50 is 8.41 ng/mL. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability to human ACE2 in a functional ELISA. Immobilized SARS-CoV S-RBD at 3 μg/mL can bind human ACE2, the EC50 is 8.41 ng/mL.
Source	Mammalian cell
Species	Human SARS coronavirus (SARS-CoV)
Fragment	306-527 aa
Sequence	RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF
Tag	10xHis-tag at the N-terminus and Myc-tag at the C-terminus
Predicted MW	30 kDa
Purity	>95%, determined by SDS-PAGE.
Endotoxin Level	<1.0 EU/μg, determined by the LAL method.
Conjugation	Unconjugated

Target	S
Full Name	Spike glycoprotein
Uniprot ID	P59594
Background	Spike protein S1 attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. Spike protein S2 mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein.
Alternate Names	S glycoprotein; E2; Peplomer protein