0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human T-cell leukemia virus 1 (HTLV-1) Envelope glycoprotein gp62 (Env) (21-312 aa) [His-SUMO-tag], E. coli (CAT#: GP03-178J)

Datasheet
SizeQtyAdd To Basket
100 μg
1 mg

Product Overview Recombinant Human T-cell leukemia virus 1 (HTLV-1) Envelope glycoprotein gp62 (21-312 aa) was expressed in E. coli with a 6xHis-SUMO-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Human T-cell leukemia virus 1 (HTLV-1)
Fragment 21-312 aa
Sequence DYSPSCCTLTIGVSSYHSKPCNPAQPVCSWTLDLLALSADQALQPPCPNLVSYSSYHATYSLYLFPHWTKKPNRNGGGYYSASYSDPCSLKCPYLGCQSWTCPYTGAVSSPYWKFQHDVNFTQEVSRLNINLHFSKCGFPFSLLVDAPGYDPIWFLNTEPSQLPPTAPPLLPHSNLDHILEPSIPWKSKLLTLVQLTLQSTNYTCIVCIDRASLSTWHVLYSPNVSVPSSSSTPLLYPSLALPAPHLTLPFNWTHCFDPQIQAIVSSPCHNSLILPPFSLSPVPTLGSRSRR
Tag 6xHis-SUMO-tag at the N-terminus
Predicted MW 36.0 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target Env
Full Name Envelope glycoprotein gp62
Uniprot ID P03381
Background The transmembrane protein (TM) acts as a class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state.
Alternate Names Env polyprotein; Envelope glycoprotein gp62
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on