There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 1 mg | ||
| 500 μg | ||
| 100 μg |
| Product Overview | Recombinant Human T-cell surface glycoprotein CD8 alpha chain (NP_001139345.1) (22-182 aa) was expressed in Mammalian cell with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP. |
| Biological Activity | Determined by its binding ability in a functional ELISA. |
| Source | Mammalian cell |
| Species | Human |
| Fragment | 22-182 aa |
| Sequence | SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD |
| Tag | 6xHis-tag at the N-terminus |
| Predicted MW | 21.6 kDa |
| Purity | >90%, determined by SDS-PAGE. |
| Conjugation | Unconjugated |
| Target | CD8A |
| Full Name | T-cell surface glycoprotein CD8 alpha chain |
| Gene ID | 925 |
| Uniprot ID | P01732 |
| Accession Number | NP_001139345.1 |
| Background | Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs). |
| Alternate Names | T-lymphocyte differentiation antigen T8/Leu-2; CD8a |