Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A) (22-182 aa) [6xHis-tag], Mammalian cell (CAT#: GPX04-127J)

Product Overview	Recombinant Human T-cell surface glycoprotein CD8 alpha chain (NP_001139345.1) (22-182 aa) was expressed in Mammalian cell with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	Mammalian cell
Species	Human
Fragment	22-182 aa
Sequence	SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
Tag	6xHis-tag at the N-terminus
Predicted MW	21.6 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	CD8A
Full Name	T-cell surface glycoprotein CD8 alpha chain
Gene ID	925
Uniprot ID	P01732
Accession Number	NP_001139345.1
Background	Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs).
Alternate Names	T-lymphocyte differentiation antigen T8/Leu-2; CD8a