0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human Tumor associated calcium signal transducer 2 (TACSTD2) (27-274 aa) [hFc-Tag], Mammalian cell (CAT#: GP02-150J)

Datasheet
SizeQtyAdd To Basket
100 μg

Product Overview Recombinant Human Tumor associated calcium signal transducer 2 (NP_002344.2) (27-274 aa) was expressed in Mammalian cell with a hFc-tag at the C-terminus. The biological activity was determined in cell activity assay using U937 cells. The EC50 is 185.4 ng/mL. This product can be used in ELISA, WB, IP.
Biological Activity Determined in cell activity assay using U937 cells. The EC50 is 185.4 ng/mL.
Source Mammalian cell
Species Human
Fragment 27-274 aa
Sequence HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Tag hFc-tag at the C-terminus
Predicted MW 56.8 kDa
Purity >95%, determined by SDS-PAGE.
Endotoxin Level <1.0 EU/μg, determined by the LAL method.
Conjugation Unconjugated
Target TACSTD2
Full Name Tumor associated calcium signal transducer 2
Gene ID 4070
Uniprot ID P09758
Accession Number NP_002344.2
Background This protein is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy.
Alternate Names EGP1; GP50; M1S1; EGP-1; TROP2; GA7331; GA733-1
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
  • ()
    ()
    ()
ISO 9001 Certified - Creative Biolabs Quality Management System.