0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Kemp's ridley sea turtle Rathke gland glycoprotein (1-30 aa) [His-tag], E. coli (CAT#: GP03-186J)

Datasheet
SizeQtyAdd To Basket
100 μg
500 μg
1 mg

Product Overview Recombinant Kemp's ridley sea turtle Rathke gland glycoprotein (1-30 aa) was expressed in E. coli with a His-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Kemp's ridley sea turtle
Fragment 1-30 aa
Sequence SDDDGTVVLTTSGPIRGKRLQVGSAAVTAF
Tag His-tag at the N-terminus
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target Rathke gland glycoprotein
Full Name Rathke gland glycoprotein
Uniprot ID P21587
Background Rathke gland secretions may function as pheromones, as predator repellents, or contribute to the maintenance of the turtle shell.
Alternate Names Glycoprotein
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
Close
Thanksgiving
Thanksgiving