Recombinant Kemp's ridley sea turtle Rathke gland glycoprotein (1-30 aa) [His-tag], HEK 293-F cell (CAT#: GP03-188J)

Product Overview	Recombinant Kemp's ridley sea turtle Rathke gland glycoprotein (1-30 aa) was expressed in HEK 293-F cell with a His-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	HEK 293-F cell
Species	Kemp's ridley sea turtle
Fragment	1-30 aa
Sequence	SDDDGTVVLTTSGPIRGKRLQVGSAAVTAF
Tag	His-tag at the N-terminus
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	Rathke gland glycoprotein
Full Name	Rathke gland glycoprotein
Uniprot ID	P21587
Background	Rathke gland secretions may function as pheromones, as predator repellents, or contribute to the maintenance of the turtle shell.
Alternate Names	Glycoprotein