There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 100 μg | ||
| 500 μg | ||
| 1 mg |
| Product Overview | Recombinant Kemp's ridley sea turtle Rathke gland glycoprotein (1-30 aa) was expressed in CHO cell with a His-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
| Biological Activity | Determined by its binding ability in a functional ELISA. |
| Source | CHO cell |
| Species | Kemp's ridley sea turtle |
| Fragment | 1-30 aa |
| Sequence | SDDDGTVVLTTSGPIRGKRLQVGSAAVTAF |
| Tag | His-tag at the N-terminus |
| Purity | >90%, determined by SDS-PAGE. |
| Conjugation | Unconjugated |
| Target | Rathke gland glycoprotein |
| Full Name | Rathke gland glycoprotein |
| Uniprot ID | P21587 |
| Background | Rathke gland secretions may function as pheromones, as predator repellents, or contribute to the maintenance of the turtle shell. |
| Alternate Names | Glycoprotein |