0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Lymphocytic choriomeningitis virus (strain Armstrong) Envelope glycoprotein (266-498 aa) [His-SUMO], E. coli (CAT#: GP02-157J)

Datasheet
SizeQtyAdd To Basket
100 μg
1 mg

Product Overview Recombinant Lymphocytic choriomeningitis virus (strain Armstrong)Envelope glycoprotein (266-498 aa) was expressed in E. coli with a 6xHis-SUMO-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source E. coli
Species Lymphocytic choriomeningitis virus (strain Armstrong)
Fragment 266-498 aa
Sequence GTFTWTLSDSSGVENPGGYCLTKWMILAAELKCFGNTAVAKCNVNHDAEFCDMLRLIDYNKAALSKFKEDVESALHLFKTTVNSLISDQLLMRNHLRDLMGVPYCNYSKFWYLEHAKTGETSVPKCWLVTNGSYLNETHFSDQIEQEADNMITEMLRKDYIKRQGSTPLALMDLLMFSTSAYLVSIFLHLVKIPTHRHIKGGSCPKPHRLTNKGICSCGAFKVPGVKTVWKRR
Tag 6xHis-SUMO-tag at the N-terminus
Predicted MW 42.4 kDa
Purity >95%, determined by SDS-PAGE.
Conjugation Unconjugated
Target Envelope glycoprotein
Full Name Envelope glycoprotein
Gene ID 956591
Uniprot ID P09991
Background Glycoprotein G1 interacts with the host receptor.
Mediates virus attachment to host receptor alpha-dystroglycan DAG1. This attachment induces virion internalization predominantly through clathrin- and caveolin-independent endocytosis. Glycoprotein G2 is a class I viral fusion protein that directs fusion of viral and host endosomal membranes, leading to delivery of the nucleocapsid into the cytoplasm. Membrane fusion is mediated by irreversible conformational changes induced upon acidification in the endosome.
Alternate Names GPC; GP-C; Segment; SPre-glycoprotein polyprotein GP complex; Pre-GP-C) [Cleaved into: Stable signal peptide; SSP); Glycoprotein G1; GP1); Glycoprotein G2; GP2)]
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
  • ()
    ()
    ()
ISO 9001 Certified - Creative Biolabs Quality Management System.
Close
Thanksgiving
Thanksgiving