Recombinant Mouse Biglycan (BGN) protein (Ile242-Lys369) [His-Tag], E. coli (CAT#: GP01-031J)

Product Overview	Recombinant Mouse Biglycan (BGN) protein (NP_031568.2) (Ile242-Lys369) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Mouse
Fragment	Ile242-Lys369
Sequence	MGHHHHHHSGSEFIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLSRVPAGLPDLKLLQVVYLHSNNITKVGINDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK
Tag	His-Tag at the N-terminus
Predicted MW	16.2 KDa
Purity	>95%, determined by SDS-PAGE and HPLC
Endotoxin Level	<1 EU/μg, determined by the LAL method
Conjugation	Unconjugated

Target	BGN
Full Name	Biglycan
Gene ID	12111
Uniprot ID	P28653
Accession Number	NP_031568.2
Background	This gene encodes a small, leucine-rich repeat proteoglycan that plays important roles in bone mineralization and connective tissue metabolism. The encoded preproprotein undergoes post-translational processing during which chondroitin sulfate or dermatan sulfate chains are attached before incorporation into the extracellular matrix. Mice lacking the encoded protein exhibit reduced growth rate and acquire diminished bone mass progressively with age.
Alternate Names	S; BG; PGI; DSPG1; PG-S1; SLRR1A; BGN; Biglycan