Recombinant Mouse Biglycan (BGN) protein (Ile242-Lys369) [His-Tag], E. coli

Recombinant Mouse Biglycan (BGN) protein (NP_031568.2) (Ile242-Lys369) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.

Determined by its binding ability in a functional ELISA.

Mouse

Ile242-Lys369

MGHHHHHHSGSEFIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLSRVPAGLPDLKLLQVVYLHSNNITKVGINDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK

His-Tag at the N-terminus

16.2 KDa

>95%, determined by SDS-PAGE and HPLC

<1 EU/μg, determined by the LAL method

Unconjugated

BGN

Biglycan

This gene encodes a small, leucine-rich repeat proteoglycan that plays important roles in bone mineralization and connective tissue metabolism. The encoded preproprotein undergoes post-translational processing during which chondroitin sulfate or dermatan sulfate chains are attached before incorporation into the extracellular matrix. Mice lacking the encoded protein exhibit reduced growth rate and acquire diminished bone mass progressively with age.

S; BG; PGI; DSPG1; PG-S1; SLRR1A; BGN; Biglycan