There is no product in the shopping cart, buy it!
Size | Qty | Add To Basket |
---|---|---|
10 μg | ||
50 μg | ||
200 μg |
Product Overview | Recombinant Mouse Biglycan (BGN) protein (NP_031568.2) (Ile242-Lys369) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
Biological Activity | Determined by its binding ability in a functional ELISA. |
Source | E. coli |
Species | Mouse |
Fragment | Ile242-Lys369 |
Sequence | MGHHHHHHSGSEFIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLSRVPAGLPDLKLLQVVYLHSNNITKVGINDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK |
Tag | His-Tag at the N-terminus |
Predicted MW | 16.2 KDa |
Purity | >95%, determined by SDS-PAGE and HPLC |
Endotoxin Level | <1 EU/μg, determined by the LAL method |
Conjugation | Unconjugated |
Target | BGN |
Full Name | Biglycan |
Gene ID | 12111 |
Uniprot ID | P28653 |
Accession Number | NP_031568.2 |
Background | This gene encodes a small, leucine-rich repeat proteoglycan that plays important roles in bone mineralization and connective tissue metabolism. The encoded preproprotein undergoes post-translational processing during which chondroitin sulfate or dermatan sulfate chains are attached before incorporation into the extracellular matrix. Mice lacking the encoded protein exhibit reduced growth rate and acquire diminished bone mass progressively with age. |
Alternate Names | S; BG; PGI; DSPG1; PG-S1; SLRR1A; BGN; Biglycan |