Recombinant Mouse Glycoprotein hormone beta 5 (Gphb5) (25-130 aa) [His-Tag], Yeast (CAT#: GP02-056J)

Product Overview	Recombinant Mouse Glycoprotein hormone beta 5 (NP_783575.2) (25-130 aa) was expressed in Yeast with a 6xHis-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	Yeast
Species	Mouse
Fragment	25-130 aa
Sequence	SSSGNLHTFVGCAVREFTFMAKKPGCRGLRITTDACWGRCETWEKPILEPPYIEAYHRVCTYNETRQVTVKLPNCAPGVDPFYTYPMAVRCDCGACSTATTECETI
Tag	6xHis-tag at the C-terminus
Predicted MW	13.3 kDa
Purity	>95%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	Gphb5
Full Name	Glycoprotein hormone beta 5
Gene ID	217674
Uniprot ID	Q812B2
Accession Number	NP_783575.2
Background	This protein functions as a heterodimeric glycoprotein hormone with GPHA2 able to bind and activate the thyroid-stimulating hormone receptor (TSHR), leading to increased cAMP production. Plays a central role in controlling thyroid cell metabolism.
Alternate Names	OG; OGH; Zlut; Zlut1