There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 10 μg | ||
| 50 μg | ||
| 200 μg |
| Product Overview | Recombinant Mouse Leucine-rich alpha-2-glycoprotein 1 (LRG1) (NP_084072.1) (Ser136-Leu342) was expressed in E. coli with a His-tag and GST-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
| Biological Activity | Determined by its binding ability in a functional ELISA. |
| Source | E. coli |
| Species | Mouse |
| Fragment | Ser136-Leu342 |
| Sequence | MRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSTSGSGHHHHHHSAGLVPRGSTAIGMKETAAAKFERQHMDSPDLGTLEVLFQGPLGSEFSANLSTLVLRENQLREVSAQWLQGLDALGHLDLAENQLSSLPSGLLASLGALHTLDLGYNLLESLPEGLLRGPRRLQRLHLEGNRLQRLEDSLLAPQPFLRVLFLNDNQLVGVATGSFQGLQHLDMLDLSNNSLSSTPPGLWAFLGRPTRDMQDGFDISHNPWICDKNLADLCRWLVANRNKMFSQNDTRCAGPEAMKGQRLLDVAELGSL |
| Tag | His-tag and GST-tag at the N-terminus |
| Predicted MW | 50.4 KDa |
| Purity | >95%, determined by SDS-PAGE and HPLC |
| Endotoxin Level | <1 EU/μg, determined by the LAL method |
| Conjugation | Unconjugated |
| Target | LRG1 |
| Full Name | Leucine-rich alpha-2-glycoprotein 1 |
| Gene ID | 76905 |
| Uniprot ID | Q91XL1 |
| Accession Number | NP_084072.1 |
| Background | Leucine-rich alpha-2-glycoprotein (LRG) is a secretory type 1 acute phase protein whose expression is upregulated by the mediators of acute-phase response. |
| Alternate Names | Lr; Lrg; Lrhg; 1300008B03Rik; 2310031E04Rik; LRG1; Leucine-rich alpha-2-glycoprotein 1 |