Recombinant Mouse Platelet glycoprotein Ib beta chain (GP1BB) (27-206 aa), E. coli (CAT#: GPX04-312J)

Product Overview	Recombinant Mouse Platelet glycoprotein Ib beta chain (NP_034457.1) (27-206 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Mouse
Fragment	27-206 aa
Sequence	PAPCSCAGTLVDCGRRGLTWASLPAAFPPDTTELVLTGNNLTALPPGLLDALPALRAAHLGANPWRCDCRLLPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYVAEDELRAACAPGLLCWGALVAQLALLVLGLLHALLLALLLGRLRRLRARARARSIQEFSLTAPLVAESARGGAS
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	GP1BB
Full Name	Platelet glycoprotein Ib beta chain
Gene ID	14724
Uniprot ID	P56400
Accession Number	NP_034457.1
Background	Gp-Ib, a surface membrane protein of platelets, participates in the formation of platelet plugs by binding to von Willebrand factor, which is already bound to the subendothelium.
Alternate Names	GP-Ib beta; GPIb-beta; GPIbB; Antigen CD42b-beta; CD42c