Recombinant Rat Alpha-1-acid glycoprotein (ORM1) (19-205 aa) [Tag free], E. coli (CAT#: GPX04-371J)

Product Overview	Recombinant Rat Alpha-1-acid glycoprotein (NP_445740.1) (19-205 aa) was expressed in E. coli with a Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Rat
Fragment	19-205 aa
Sequence	QNPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAVQTIQTEYFYLTPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFAHLIVLKKHGTFMLAFNLTDENRGLSFYAKKPDLSPELRKIFQQAVKDVGMDESEIVFVDWTKDKCSEQQKQQLELEKETKKETKKDP
Tag	Tag free
Predicted MW	21.6 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	ORM1
Full Name	Alpha-1-acid glycoprotein
Gene ID	24614
Uniprot ID	P02764
Accession Number	NP_445740.1
Background	Functions as transport protein in the blood stream. Binds various ligands in the interior of its beta-barrel domain.
Alternate Names	Orosomucoid; OMD