There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 1 mg | ||
| 500 μg | ||
| 100 μg |
| Product Overview | Recombinant Rat Alpha-1-acid glycoprotein (NP_445740.1) (19-205 aa) was expressed in E. coli with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP. |
| Biological Activity | Determined by its binding ability in a functional ELISA. |
| Source | E. coli |
| Species | Rat |
| Fragment | 19-205 aa |
| Sequence | QNPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAVQTIQTEYFYLTPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFAHLIVLKKHGTFMLAFNLTDENRGLSFYAKKPDLSPELRKIFQQAVKDVGMDESEIVFVDWTKDKCSEQQKQQLELEKETKKETKKDP |
| Tag | 6xHis-tag at the N-terminus |
| Predicted MW | 25.7 kDa |
| Purity | >90%, determined by SDS-PAGE. |
| Conjugation | Unconjugated |
| Target | ORM1 |
| Full Name | Alpha-1-acid glycoprotein |
| Gene ID | 24614 |
| Uniprot ID | P02764 |
| Accession Number | NP_445740.1 |
| Background | Functions as transport protein in the blood stream. Binds various ligands in the interior of its beta-barrel domain. |
| Alternate Names | Orosomucoid; OMD |