0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Rat Alpha-1-acid glycoprotein (ORM1) (19-205 aa) [6xHis-tag], E. coli (CAT#: GPX04-372J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Rat Alpha-1-acid glycoprotein (NP_445740.1) (19-205 aa) was expressed in E. coli with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Rat
Fragment 19-205 aa
Sequence QNPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAVQTIQTEYFYLTPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFAHLIVLKKHGTFMLAFNLTDENRGLSFYAKKPDLSPELRKIFQQAVKDVGMDESEIVFVDWTKDKCSEQQKQQLELEKETKKETKKDP
Tag 6xHis-tag at the N-terminus
Predicted MW 25.7 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target ORM1
Full Name Alpha-1-acid glycoprotein
Gene ID 24614
Uniprot ID P02764
Accession Number NP_445740.1
Background Functions as transport protein in the blood stream. Binds various ligands in the interior of its beta-barrel domain.
Alternate Names Orosomucoid; OMD
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on