Recombinant Rat Chitinase 3 like 1 (Chi3l1) (20-381 aa) [His/Myc-Tag], E. coli (CAT#: GP02-022J)

Product Overview	Recombinant Rat Chitinase 3 like 1 (NP_446012.2) (20-381 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	E. coli
Species	Rat
Fragment	20-381 aa
Sequence	YKLVCYYTNWSQYREGNGSCFPDALDHSLCTHIIYSFANISNNKLSTSEWNDVTLYGMLNTLKTRNPRLKTLLSVGGWSFGSERFSRIVSNAKSRKTFVQSVAPFLRTYGFDGLDLAWLYPGPKDKQHFTTLIKELKAEFTKEVQPGTEKLLLSAAVSAGKVTLDSGYDVAQIAQHLDFINLMTYDFHGTWRHTTGHHSPLFRGQQDTGPDRFSNVDYGVGYMLRLGAPTNKLVMGIPTFGKSFTLASSENQVGAPITGSGLPGRYTKEKGTLAYYEICDFLRGAEVHRILGQQVPFATKGNQWVGYDDPESVKNKVKYLKNKQLAGAMVWAVDLDDFRGSFCGHNVHFPLTNAIKEALAVA
Tag	10xHis-tag at the N-terminus and Myc-tag at the C-terminus
Predicted MW	45.4 kDa
Purity	>95%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	Chi3l1
Full Name	Chitinase 3 like 1
Gene ID	89824
Uniprot ID	Q9WTV1
Accession Number	NP_446012.2
Background	This protein may play a role in tissue remodeling and in the capacity of cells to respond to and cope with changes in their environment. Plays a role in T-helper cell type 2 (Th2) inflammatory response and IL-13-induced inflammation, regulating allergen sensitization, inflammatory cell apoptosis, dendritic cell accumulation and M2 macrophage differentiation. Facilitates invasion of pathogenic enteric bacteria into colonic mucosa and lymphoid organs.
Alternate Names	Cartilage glycoprotein 39; CGP-39; GP-39