0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Rat Chitinase 3 like 1 (Chi3l1) (20-381 aa) [His/Myc-Tag], E. coli (CAT#: GP02-022J)

Datasheet
SizeQtyAdd To Basket
100 μg
1 mg

Product Overview Recombinant Rat Chitinase 3 like 1 (NP_446012.2) (20-381 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source E. coli
Species Rat
Fragment 20-381 aa
Sequence YKLVCYYTNWSQYREGNGSCFPDALDHSLCTHIIYSFANISNNKLSTSEWNDVTLYGMLNTLKTRNPRLKTLLSVGGWSFGSERFSRIVSNAKSRKTFVQSVAPFLRTYGFDGLDLAWLYPGPKDKQHFTTLIKELKAEFTKEVQPGTEKLLLSAAVSAGKVTLDSGYDVAQIAQHLDFINLMTYDFHGTWRHTTGHHSPLFRGQQDTGPDRFSNVDYGVGYMLRLGAPTNKLVMGIPTFGKSFTLASSENQVGAPITGSGLPGRYTKEKGTLAYYEICDFLRGAEVHRILGQQVPFATKGNQWVGYDDPESVKNKVKYLKNKQLAGAMVWAVDLDDFRGSFCGHNVHFPLTNAIKEALAVA
Tag 10xHis-tag at the N-terminus and Myc-tag at the C-terminus
Predicted MW 45.4 kDa
Purity >95%, determined by SDS-PAGE.
Conjugation Unconjugated
Target Chi3l1
Full Name Chitinase 3 like 1
Gene ID 89824
Uniprot ID Q9WTV1
Accession Number NP_446012.2
Background This protein may play a role in tissue remodeling and in the capacity of cells to respond to and cope with changes in their environment. Plays a role in T-helper cell type 2 (Th2) inflammatory response and IL-13-induced inflammation, regulating allergen sensitization, inflammatory cell apoptosis, dendritic cell accumulation and M2 macrophage differentiation. Facilitates invasion of pathogenic enteric bacteria into colonic mucosa and lymphoid organs.
Alternate Names Cartilage glycoprotein 39; CGP-39; GP-39
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on