Recombinant Rat Uromodulin (UMOD) protein [His-tag and T7-tag], E. coli (CAT#: GP01-128J)

Product Overview	Recombinant Rat Uromodulin (UMOD) protein (NP_058778.1) (Glu30-Glu150) was expressed in E. coli with a His-tag and T7-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Rat
Fragment	Glu30-Glu150
Sequence	MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEARRCSECHDNATCVLDGVVTTCSCQAGFTGDGLVCEDIDECATPWTHNCSNSICMNTLGSYECSCQDGFRLTPGLGCIDVNECTEQGLSNCHSLATCVNTEGSYSCVCPKGYRGDGWYCE
Tag	His-tag and T7-tag at the N-terminus
Predicted MW	16.5 KDa
Purity	>95%, determined by SDS-PAGE and HPLC
Endotoxin Level	<1 EU/μg, determined by the LAL method
Conjugation	Unconjugated

Target	UMOD
Full Name	Uromodulin
Gene ID	25128
Uniprot ID	P27590
Accession Number	NP_058778.1
Background	Mutation of the human homolog is associated with medullary cystic kidney disease 2 and familial juvenile hyperuricaemic nephropathy.
Alternate Names	THP; UMOD; Uromodulin