0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Rat Uromodulin (UMOD) protein [His-tag and T7-tag], E. coli (CAT#: GP01-128J)

Datasheet
SizeQtyAdd To Basket
10 μg
50 μg
200 μg

Product Overview Recombinant Rat Uromodulin (UMOD) protein (NP_058778.1) (Glu30-Glu150) was expressed in E. coli with a His-tag and T7-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Rat
Fragment Glu30-Glu150
Sequence MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEARRCSECHDNATCVLDGVVTTCSCQAGFTGDGLVCEDIDECATPWTHNCSNSICMNTLGSYECSCQDGFRLTPGLGCIDVNECTEQGLSNCHSLATCVNTEGSYSCVCPKGYRGDGWYCE
Tag His-tag and T7-tag at the N-terminus
Predicted MW 16.5 KDa
Purity >95%, determined by SDS-PAGE and HPLC
Endotoxin Level <1 EU/μg, determined by the LAL method
Conjugation Unconjugated
Target UMOD
Full Name Uromodulin
Gene ID 25128
Uniprot ID P27590
Accession Number NP_058778.1
Background Mutation of the human homolog is associated with medullary cystic kidney disease 2 and familial juvenile hyperuricaemic nephropathy.
Alternate Names THP; UMOD; Uromodulin
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
Close
Thanksgiving
Thanksgiving