0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Rotavirus A Non-structural glycoprotein 4 (52-175 aa) [6xHis-KSI-tag], E. coli (CAT#: GPX04-395J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) Non-structural glycoprotein 4 (52-175 aa) was expressed in E. coli with a 6xHis-KSI-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ])
Fragment 52-175 aa
Sequence PTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMERVVKEMRRHFKMIDKLTTREIEQVGLLKRIHDKLDIRAVDEIDMTKEINQKNVRTLEEWEWGKNPYEPKEVTAAM
Tag 6xHis-KSI-tag at the N-terminus
Predicted MW 30.1 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target Non-structural glycoprotein 4
Full Name Non-structural glycoprotein 4
Uniprot ID Q9PYC8
Background Plays an essential role in the virus replication cycle by acting as a viroporin.
Alternate Names NCVP5; NS28
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
Close
Thanksgiving
Thanksgiving