0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Rotavirus A Outer capsid glycoprotein vp7 (34-309 aa) [His/Myc-Tag], E. coli (CAT#: GP02-159J)

Datasheet
SizeQtyAdd To Basket
100 μg
1 mg

Product Overview Recombinant Rotavirus AOuter capsid glycoprotein vp7 (34-309 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source E. coli
Species Rotavirus A
Fragment 34-309 aa
Sequence QNYGVNLPITGSMDTAYANSTQSEPFLTSTLCLYYPVEASNEIADTEWKDTLSQLFLTKGWPTGSVYLKEYADIAAFSVEPQLYCDYNLVLMKYDSTQELDMSELADLILNEWLCNPMDITLYYYQQTDEANKWISMGSSCTVKVCPLNTQTLGIGCLITNPDTFETVATTEKLVITDVVDGVSHKLNVTTATCTIRNCKKLGPKENVAVIQVGGANILDITADPTTTPQTERMMAIIWKKWWQVVYPVVDYVNQIIQTMSKRSRSLNSSAFYYRV
Tag 10xHis-tag at the N-terminus and Myc-tag at the C-terminus
Predicted MW 36.0 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target Outer capsid glycoprotein vp7
Full Name Outer capsid glycoprotein vp7
Uniprot ID A8D8S8
Background This protein is a calcium-binding protein that interacts with rotavirus cell receptors once the initial attachment by VP4 has been achieved. Rotavirus attachment and entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors.
Alternate Names Outer capsid glycoprotein VP7; Fragment
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on