Recombinant Rotavirus A Outer capsid glycoprotein vp7 (34-309 aa) [His/Myc-Tag], E. coli (CAT#: GP02-159J)

Product Overview	Recombinant Rotavirus AOuter capsid glycoprotein vp7 (34-309 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	E. coli
Species	Rotavirus A
Fragment	34-309 aa
Sequence	QNYGVNLPITGSMDTAYANSTQSEPFLTSTLCLYYPVEASNEIADTEWKDTLSQLFLTKGWPTGSVYLKEYADIAAFSVEPQLYCDYNLVLMKYDSTQELDMSELADLILNEWLCNPMDITLYYYQQTDEANKWISMGSSCTVKVCPLNTQTLGIGCLITNPDTFETVATTEKLVITDVVDGVSHKLNVTTATCTIRNCKKLGPKENVAVIQVGGANILDITADPTTTPQTERMMAIIWKKWWQVVYPVVDYVNQIIQTMSKRSRSLNSSAFYYRV
Tag	10xHis-tag at the N-terminus and Myc-tag at the C-terminus
Predicted MW	36.0 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	Outer capsid glycoprotein vp7
Full Name	Outer capsid glycoprotein vp7
Uniprot ID	A8D8S8
Background	This protein is a calcium-binding protein that interacts with rotavirus cell receptors once the initial attachment by VP4 has been achieved. Rotavirus attachment and entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors.
Alternate Names	Outer capsid glycoprotein VP7; Fragment